Содержание

Отчеты Метрики. Статистика посещаемости сайта

Статистика посещаемости сайта — это необходимый инструмент для понимания эффективности работы сайта и качества аудитории, двух основополагающих факторов успешного интернет-ресурса. Статистика посещаемости площадки собирается по данным инструмента анализа посещаемости сайта — Яндекс.Метрики, которая встроена в код для показа рекламных блоков. Обратите внимание, что данные, которые собираются с помощью встроенного в рекламный код счетчика Метрики, доступны только для чтения. Редактировать этот счетчик нельзя.

Совет.

Как правило, рекламный код РСЯ устанавливается не на всех страницах сайта, и собираемые Метрикой данные могут оказаться неполными. Поэтому мы рекомендуем создать и настроить в Метрике новый счетчик и установить его код на все страницы сайта. Это позволит повысить точность определения качества сайта и получить дополнительные отчеты о его посещаемости. Счетчик Метрики не показывает рекламу и служит только для сбора данных.

Яндекс.Метрика помогает участникам Рекламной сети Яндекса сделать выводы:

  • о том, как ведут себя посетители на сайте партнера:

    • какой контент им наиболее интересен: какие разделы и страницы посещаются чаще всего, а какие практически не представляют интереса для пользователей;

    • удобна ли навигация сайта: какие элементы навигации используются активно, а какие не используются, либо не видны пользователям;

    • просматривается ли контент полностью, или пользователь по различным причинам уходит со страниц;

  • о том, насколько удачно расположены рекламные блоки:

    • попадают ли блоки в зону видимости пользователя;

    • не мешают ли блоки работе с контентом сайта;

    • какие рекламные места дают наибольший CTR и почему.

Чтобы просмотреть отчет по площадке в интерфейсе Яндекс.Метрики, перейдите к списку площадок ( или ) и нажмите кнопку Отчеты Метрики в строке с нужной площадкой.

Метрика работает по традиционному принципу онлайн-счетчиков: код, установленный на страницах вашего сайта, регистрирует каждое посещение, собирая о нем данные. В Яндекс.Метрике формируются отчеты и карты действий пользователей. Владельцам площадок Рекламной сети могут быть полезны следующие возможности Яндекс.Метрики:

Подробное описание этих возможностей приведено в Справке Яндекс.Метрики.

Сводка — это главная страница вашей Метрики, которая дает возможность быстро получить информацию о трафике и другие важные показатели.



Отчет показывает уровень трафика за любой необходимый отрезок времени.



С его помощью можно определить общую динамику пользовательского трафика на сайте и, понимая зависимость «трафик — доход», прогнозировать уровень дохода вашего сайта.



Для оценки качества трафика необходимо понимать, откуда он пришел. Это можно посмотреть в отчетах из меню , например, Сайты, Поисковые фразы или Социальные сети.



Некачественный трафик понизит показатели вашего сайта и отрицательно скажется на доходе. Оптимально, если основу трафика сайта составляет естественный поисковый трафик.



Отчеты меню позволяют оценить социально-демографический состав и интересы аудитории сайта. Это может быть важно для оценки эффективности работы блоков Рекламной сети Яндекса.

Отчет Долгосрочные интересы показывает, какие тематики наиболее интересны посетителям вашего сайта. Зная предпочтения посетителей вы можете определить направление развития сайта.

Отчет География поможет разобраться в географии аудитории.



Отчеты блока Демография позволят вам оценить распределение по полу и возрасту.





Отчеты блока Активность позволяют узнать, сколько времени посетители просматривают ваш сайт, какова глубина просмотра и как посещаемость зависит от времени суток.

Отчеты блока Лояльность позволяют оценить количество визитов одного посетителя, периодичность визитов, интервал времени между двумя последними визитами и интервал времени между самым первым и последним визитом пользователя.



Отчеты меню позволяют определить наиболее посещаемые страницы вашего сайта, параметры визитов посетителей (например, используемую валюту или язык), используемые параметры URL. Вы можете узнать, на какие страницы сайта приходят пользователи, после просмотра каких страниц они уходят с сайта, какими страницами делятся в социальных сетях. Анализ этой информации поможет вам предсказать поведение вашей аудитории и распределить приоритеты во время улучшения качества страниц.

Отчеты меню позволяют определить программное обеспечение и устройства, с помощью которых пользователи просматривают сайт. Информация об операционных системах и браузерах посетителей, о разрешении дисплеев, о наличии и версиях Flash-плагина, Java, JavaScript и Silverlight представлена в соответствующих отчетах. Убедитесь, что ваш сайт корректно отображается в популярных браузерах.



Отчеты меню позволяют отслеживать доступность сайта, нагрузку на него в режиме реального времени, среднее время загрузки страниц и количество посетивших сайт роботов.



Анализ отчетов мониторинга помогает отследить вероятные проблемы с доступом к сайту (например, если сайт не выдержит нагрузки от большого количества посетителей).



Отчеты меню позволяют оценить доходы от показа рекламы с помощью различных показателей. Например, вы сможете выявить самые прибыльные источники трафика или проверить эффективность показа рекламы на разных страницах сайта.

Отчеты группы Монетизация подключаются в интерфейсе Рекламной сети Яндекса. Выберите нужную площадку в списке ( или ) и нажмите Редактировать. На вкладке Общие включите опцию Показывать отчеты по РСЯ в Метрике и добавьте номер счетчика в поле Счетчики Метрики.

Отчеты появятся в Яндекс.Метрике в течение суток после того, как вы подключите их в РСЯ.

Подробнее об отчетах группы Монетизация в Справке Яндекс.Метрики

Любой отчет Яндекс.Метрики можно изменить для более полного и точного измерения необходимых показателей вашего ресурса. Сохраненные пользовательские отчеты будут доступны в меню .

Карты позволяют понять логику поведения пользователей сайта:

  • Карта ссылок — это инструмент для измерения статистики переходов по ссылкам на вашем сайте.

  • Карта кликов (часто ее называют тепловой картой, но она имеет больший функций, нежели традиционная тепловая карта) — инструмент для измерения и отображения статистики по кликам на вашем сайте. В отличие от карты ссылок, она отображает клики по всем элементам страницы, а не только по ссылкам.

  • Карта скроллинга показывает, как распределяется внимание посетителей по странице. Эта информация поможет вам при размещении блоков Рекламной сети Яндекса.

  • Аналитика форм позволяет понять, как посетители вашего сайта взаимодействуют с формами. Для каждой формы можно узнать конверсию, среднее время заполнения и поля, на которых посетители уходят с формы.

Вебвизор воспроизводит действия посетителей в формате видео и позволяет узнать об их поведении на сайте: как они перемещаются по странице, передвигают курсор мыши и переходят по ссылкам.

Подключение статистики Яндекc.Метрика – Справочный центр Vigbo

Для оценки посещаемости сайта, анализа поведения пользователей и отслеживания источников трафика вы можете подключить на сайт любой сервис статистики. Рассмотрим подключение Яндекс.Метрики.

1. Для использования Яндекс.Метрики вам потребуется создать аккаунт в Яндекс.Почте. Завести его можно по ссылке. Если почта уже есть, то переходите ко второму шагу.

2. Войдите в Яндекс.Метрику под логином и паролем от почты Яндекс.

3. Нажмите на кнопку Добавить счетчик.

4. Введите адрес сайта в формате domain.ru, поставьте отметку в пункте Принимать данные только с указанных адресов и примите условия «Пользовательского соглашения». По желанию включите Вебвизор. Технология Вебвизор позволяет проанализировать поведение посетителей на вашем сайте. С ее помощью вы можете воспроизвести действия посетителей в формате видео и узнать, что они делают на каждой странице, как передвигают курсор мыши, кликают по ссылкам.

Нажмите на кнопку Создать счетчик.

5. На следующем шаге выберите вариант размещения счетчика через HTML-код.

ВАЖНО: при получении кода счетчика в дополнительных настройка вы можете выбрать счетчик с информером и настроить его вид. Если убрать галочку «Информер», счетчик на сайте не будет отображаться, статистика будет доступна только в вашем аккаунте Яндекс Метрики.

6. Скопируйте полученный код счетчика и не закрывайте окно Яндекс.Метрики.

7. Перейдите в систему управления сайтом в раздел Статистика и разместите полученный код. Нажмите на кнопку Сохранить.

8. Вернитесь на страницу Яндекс.Метрики и нажмите кнопку Начать пользоваться.

ВАЖНО:
  • Увидеть информацию о посещаемости сайта на основе статистики от Яндекс.Метрики вы сможете в вашем аккаунте.
  • Если вы изменили какие-либо настройки кода счетчика, не забудьте заменить код в разделе Статистика в системе управления сайтом.
  • При возникновении вопросов или проблем, связанных с работой Яндекс.Метрики, обращайтесь в техническую поддержку данного сервиса.

Статистика Яндекс.Метрики и Google Analytics: почему данные разнятся

Seo-оптимизаторы и вебмастера регулярно отслеживают статистику посещений сайта, используя Google Analytics и Яндекс.Метрику. Даже новичок без труда заметит, что эти сервисы предоставляют разные данные по одному и тому же ресурсу. Почему так происходит и в чем причины различия статистики? Давайте разбираться в особенностях работы этих инструментов веб-аналитики.

Различия данных статистики: семь основных причин

Может показаться, что статистика в Google Analytics и отчет из Яндекс.Метрики различаются из-за наличия багов в самих счетчиках. Но это далеко не всегда так. У каждой системы своя уникальная методика учета трафика на сайт. Статистика в Яндекс.Метрике и Google Analytics представлена разными цифрами из-за семи основных причин:

1. Коды счетчиков установлены в различных местах страницы.

Например, счетчик Яндекс.Метрики размещен в начале HTML-кода страницы, а счетчик для сбора статистики Google Analytics установлен в конце кода. В результате пользователь, попавший на сайт, мгновенно учитывается Метрикой. Допустим, страница тяжелая и долго загружается. Посетитель закрывает ее, так и не дождавшись полного отображения информации, и тем самым не попадает в статистику Google.

2. Часовые пояса настроены неверно.

К примеру, в Яндекс.Метрике установлено московское время, а в Google Analytics – киевское. Системы формируют данные статистики при разных настройках времени, в результате чего распределение трафика по дням, часам и минутам происходит некорректно.

3. Один из счетчиков учитывает трафик зеркала сайта.

Так, если ресурс имеет две версии (с www и без), то для поисковых систем это два разных ресурса. Выход – склеить домен в Панели Вебмастера и административной панели сайта. Это необходимо для корректного учета трафика. Наличие такой ошибки приводит к тому, что счетчик собирает данные статистики не только с основного ресурса, но и с зеркала.

4. Есть различия в настройках фильтров.

Методика фильтрации роботов при сборе статистики в Яндекс.Метрике отличается от технологии, реализованной Google. Она предусматривает возможность исключить из общего трафика количество собственных посещений (настраивается в Панели Вебмастера). В Google такой функции нет.

5. Разный подход Google и Яндекса к учету данных.

Например, показатель отказов в Analytics может в два раза превышать аналогичный в Метрике. Связано это с тем, что Яндекс считает отказом визит, продолжительность которого составила менее 15 секунд и при этом было просмотрено не более одной страницы. Google же относит к отказам любую сессию, в течение которой пользователь просмотрел всего одну страницу.

6. Разный учет демографических характеристик.

Это одна из наиболее распространенных причин различия статистики. Пользователь может запретить Яндексу отслеживать свое местоположение, в то время как для поисковой системы Google никаких запретов не выдвигается. Кроме того, не всегда можно установить точные пол и возраст посетителя. Так, если пользователь не вошел в свой аккаунт, данные статистики будут недостоверными.

7. Прочие настройки счетчика.

Можно настроить «Таймаут визита» – временной интервал, спустя который визит считается завершенным из-за бездействия посетителя на странице. Значение тайм-аута в Аналитике может варьироваться от 1 минуты до 4-х часов, тогда как в Метрике минимальное значение – 30 минут. Попробуйте поэкспериментировать − и вы увидите, что данные статистики в отчетах будут отличаться.

Что еще нужно знать? Метрика не учитывает переходы по рекламным ссылкам Google, соответственно, Analytics делает точно так же. Google считает переходы по картинкам органическим трафиком, а Яндекс – реферальным (генерируемым в результате перехода по ссылкам с других ресурсов). Это важно учитывать для сайтов, содержащих большое количество визуального контента.

Метрика или Analytics: каким счетчиком пользоваться

Обе системы веб-аналитики имеют достоинства. Что лучше: изучать статистику в Яндекс.Метрике или отслеживать данные в Google Analytics? Как правило, современные интернет-маркетологи используют оба сервиса одновременно, поскольку у каждого из них есть свои особенности и возможности. Так, Analytics позволяет сегментировать данные по пользователям и товарам, проводить сплит-тестирование и имеет мощный функционал в разрезе оценки рекламных кампаний. В свою очередь Метрика − это возможность подсмотреть за действиями пользователя на сайте в режиме онлайн (использование вебвизора) и очень простой понятный интерфейс.

Из-за различий данных в статистике сервисов аналитики возникает закономерный вопрос: кому верить? Ориентируйтесь на статистику Google Analytics, если в вашем регионе поисковая сеть Google популярнее Яндекса или же вы запускаете рекламную кампанию именно в ней.

Если вы хотите повысить эффективность своих кампаний в интернете, тогда запишитесь на наш курс по веб-аналитике.

Поделиться с друзьями:

Яндекс Метрика на сайте Joomla

Многие сталкивались с проблемой получения статистики посещений вашего сайта, объеме аудитории и ее структуре. Отличным решением для получения данных будет установка Яндекс.Метрики на вашем Joomla сайте.

 

Как же установить Метрику на сайт?

Начнем по порядку!

  1. Для начала вам понадобиться почта на Яндексе. У кого-то, наверняка, она уже есть. А кому-то придется ее завести 🙂

  2. После создания ящика или входа под логином и паролем, перейдите на эту страницу https://metrika.yandex.ru/list? 

  3. Вы увидите диалоговое окно, в котором нажмите “Добавить счетчик”

  4. Теперь нужно заполнить данные: Имя счетчика — Произвольное название, Домен сайта — сам адрес сайта, Дополнительный домен — если у вас есть второй домен, либо если на сайт ведут несколько доменов, то просто введите их в это поле. И нажмите сохранить

  5. У вас откроется страница панели Метрики. Теперь откройте вкладку “Код счетчика”

  6. Установите галочки, как показано на скриншоте (запомните, включили ли вы Информер, от этого будет зависит вставка кода).Эти функции вам пригодятся!

  7. Скопируйте код счетчика

 

Теперь нужно решить, каким образом вы хотите вставить код на сайт.

Существует несколько вариантов:

  1. Создание модуля с кодом (модуль не будет видно, если вы не выбрали информер) в любом месте

  2. Создание модуля с информером в удобном вам месте

  3. Внесение кода в index вашего сайта

Давайте рассмотрим все эти варианты:

  1. Создание модуля с кодом

— Создайте модуль типа “HTML-код”, внесите в него содержимое кода

— Выберите положение модуля

— Отключите отображение заголовка.

Чтобы проверить, все ли вы сделали правильно — сравните то, что получилось со скриншотом.

Также не забудьте включить отображение на всех страницах сайта.

2. Создание модуля с информером

Если вы хотите, чтобы на вашем сайте отображался счетчик (что, кстати, очень удобно), то вам нужно повторить процедуру добавления модуля, как описано выше, но при настройке модуля на странице Метрики вам необходимо будет выбрать пункт “Информер”. Стоит также учесть, что как правило такие модули располагают в футере (footer — нижняя часть сайта).

3. Внесение кода в файл Index.

В данном случае вам нужно будет вставить код (без информера) в файл из директории Joomla. Это довольно удобно, если вы не хотите использовать модуль. С другой стороны, не очень удобно использовать FTP-доступ, если у вас до сих пор не установлен файловый менеджер с FTP. Топ 10 можно найти на ЭТОЙ СТРАНИЦЕ.

Итак, откройте корневую директорию вашего сайта Joomla. Найдите в ней файл index.php

Вставьте в него код счетчика перед тегом </body>.

Вот и все! Теперь на вашем сайте установлена Яндекс.Метрика!


К слову, если вы используете framework, то скорее всего в его настройке предусмотрено окно вставки подобного рода кодов и скриптов (Additional Scripts).

Например, Warp Framework, который обычно используется в шаблонах от YooTheme.

Откройте редактирование шаблона фреймверка и найдите окошко, как на скриншоте. Вставьте код Метрики в нее и и сохраните изменения. Так еще проще!

Проверьте, может быть и в вашем шаблоне есть такая функция?

 

Самых лучших показателей вам, друзья! 🙂

 

: Технологии и медиа :: РБК

Фото: Сергей Коньков / ТАСС

Со 2 июля публичный рейтинг интернет-проектов «Яндекс.Радар» продолжит показывать аудиторные данные только для сайтов экосистемы «Яндекса», говорится в письме, которое интернет-компания разослала своим партнерам (есть у РБК). Таким образом, в топе «Яндекс.Радара» не будет отображаться информация о востребованности внешних площадок.

«Яндекс.Радар» действительно прекратит публикацию рейтингов интернет-площадок, подтвердили РБК в пресс-службе «Яндекса». Это никак не скажется на других инструментах аналитики, которыми пользуются партнеры интернет-холдинга, все аналитические инструменты остаются доступными для партнеров и рекламодателей, уточнил представитель интернет-компании.

Решение отказаться от подсчета аудитории внешних проектов было принято из-за последствий пандемии коронавируса, говорится в письме. «Мы решили отказаться от развития ряда неприоритетных сервисов, требующих значительных ресурсов на поддержку», — признает пресс-служба «Яндекса».

Инструмент «Яндекс.Радар» был запущен в ноябре 2018 года. Он включал в себя 10 тыс. самых популярных у россиян интернет-ресурсов, они ранжировались исходя из показателей посещаемости. «Такой инструмент на рынке давно ждали», утверждал тогдашний коммерческий директор «Яндекса» Леонид Савков. По его словам, около 80% крупных рекламодателей и агентств планируют свой бюджет, опираясь на данные аналитических систем.

За последние 30 дней самым популярным интернет-проектом у российских пользователей, по версии «Яндекс.Радара», была сам «Яндекс» (120,5 млн посетителей), на втором месте — Google (111 млн), на третьем соцсеть «ВКонтакте» (104 млн), на четвертом — портал Mail.ru (86,8 млн), на пятом — видеосервис YouTube (81,9 млн). «Яндекс.Радар» считает пользователей, связывая все браузеры и устройства, через которые человек заходил на ресурс.

Статистика в рекламных системах: как и почему она отличается

Часто рекламная система, система аналитики и сервис Yagla показывают разные данные по одной и той же рекламной кампании. В частности, возникают расхождения в конверсиях (заявках, заказах, звонках), количестве посещений и кликов по объявлениям. Как следствие, отличаются и другие показатели, которые от них зависят – CTR, расход бюджета, средняя цена клика и т.д.

 

Не стоит беспокоиться по этому поводу, так как основные причины – в разных принципах подсчета и времени формирования статистики. В этой статье вы узнаете, какие расхождения бывают и почему.

Яндекс.Директ и Яндекс.Метрика

Ошибки в работе счетчика

Самая очевидная причина, почему визиты в Яндекс.Метрике не равны кликам в Яндекс.Директе – счетчик Метрики собирает данные на сайте не так, как надо:

 

  • Из-за ошибок в настройке

 

Чтобы самостоятельно проверить, верно ли настроен счетчик, в адресной строке браузера добавьте параметр _ym_debug со значением 1 и загрузите страницу:

 

http://example.com/?_ym_debug=1

 

Откройте консоль браузера (Ctrl + Shift + J, либо ⌥ + ⌘ + J для семейства ОС Apple). Если всё правильно, вы увидите номер вашего счетчика и данные, которые отправляет код.

 

Примеры ошибок в настройке: Метрика привязана не ко всем рекламным кампаниям, не включена опция «Размечать ссылки для Метрики».

 

  • По техническим причинам

 

Яндекс.Метрика может не засчитать клик или просмотр, если работу счетчика блокируют другие скрипты или адблоки (блокировщики рекламы, которые пользователи устанавливают в свой браузер). Либо счетчик не успевает загрузиться на сайт до того, как посетитель с него уходит.

 

Другие причины:

 

— Домен mc.yandex.ru заблокирован в файле hosts вашей ОС;

— На сайте установлен циклический редирект;

— Удаленность сервера, обслуживающего вызов счетчика, и загруженность канала интернет-провайдера.

 

Если вы заметите какую-либо из перечисленных ошибок, обратитесь в техподдержку сайта.

Отключение / блокировка файлов cookie пользователем

Яндекс.Метрика не регистрирует конверсии и другие действия на сайтах от пользователей, которые установили плагин блокировщик Яндекс.Метрики. Яндекс.Директ при этом всё равно отслеживает конверсии, вне зависимости, стоит блокировщик в браузере или нет.

Подсчет конверсий

У Метрики и Директа разные принципы расчета конверсий. Яндекс.Метрика считает все визиты на сайт, при которых пользователь оставляет заявку. Визит – это когда посетитель совершает активные действия (открывает страницы, переходит по ссылкам, загружает файлы) в течение 30 минут (время по умолчанию, его можно поменять с помощью опции тайм-аут визита).

 

В Яндекс.Директе конверсия соответствует клику, после которого она произошла.

Расчет показателя конверсии

В Яндекс.Директе он рассчитывается как отношение целевых визитов к общему числу кликов по рекламе (по объявлению, кампании, группе объявлений), а не ко всем визитам с источником «Директ». Формула следующая:

 

Коэффициент конверсии = (Целевые визиты/Клики)*100

 

В Яндекс.Метрике вместо суммы кликов берется сумма визитов на сайт:

 

Коэффициент конверсии = (Целевые визиты/Визиты)*100

Работа моделей атрибуции

И в Яндекс.Директе, и в Яндекс.Метрике по умолчанию все конверсии присваиваются последнему переходу. То есть учитывается только последний визит пользователя перед конверсией, а все предыдущие не рассматриваются. С учетом разницы в подсчете конверсий результаты имеют разное назначение.

 

Данные из Яндекс.Метрики помогают изучить в целом поведение посетителей сайта и проследить их путь от первого контакта до покупки или повторного визита. Например, вы узнаете:

 

  • Сколько времени и касаний в среднем требуется пользователю на принятие решения о покупке;
  • Какой вклад в продажи вносят разные каналы коммуникаций;
  • Если ли на сайте препятствия для аудитории, приходящей из конкретного источника трафика.

 

Отчеты в Яндекс.Директе показывают, после клика по какому именно объявлению произошла покупка, и в какие дни реклама работает лучше всего. Можно определить, какие кампании и группы объявлений в аккаунте приносят больше конверсий, а также решить, для каких объявлений, ключей и часов показа повысить / понизить ставки.

Дата конверсии

Иногда с момента первого касания до заявки уходит несколько дней и больше: пользователь изучает другие варианты и сравнивает цены.

 

Метрика разделяет клик по объявлению и событие, когда произошла заявка. Достижение цели фиксируется именно в день оформления заявки. В Директе конверсия относится к дню, когда пользователь совершил переход по объявлению, который затем привел к заявке.

 

То есть если переход по рекламе был вчера, а заявка – сегодня, в Директе конверсия отобразится за вчерашний день, а в Метрике – за сегодняшний.

Корректировка данных в отчетах

Статистика в Директе уточняется и дополняется около 3-4 дней, в редких случаях – быстрее. В итоге появляются временные расхождения между реальной статистикой и той, которая отображается в интерфейсе Яндекс.Директа.

 

Как правило, более ранняя статистика завышает число кликов и, следовательно, сумму списанного за них бюджета.

Недействительные клики

Над таблицей в Мастере отчетов Яндекс.Директа вы видите количество недействительных кликов – это клики, сделанные по ошибке или с целью «скликать» бюджет рекламодателя:

 

 

К счастью, технология Яндекса их распознает, а потраченные на них деньги автоматически возвращаются на баланс кампании.

 

Разница в следующем: в отчетах по Директу показываются данные только с учетом корректных переходов. В Яндекс.Метрике в отчете по рекламным системам учтены все клики, но посмотреть количество недействительных можно в отдельной строке:

 

Google Реклама и Google Аналитика

Неточности в системе Google Analytics

В ней есть подводные камни, которые искажают статистику, например:

 

1) Электронная почта, органический поиск и социальный трафик часто «маскируются» под прямой трафик. Причина – не настроены UTM-метки, поэтому каждый источник трафика в отдельности не отслеживается;

 

2) Битые ссылки внутри сайта снижают время посещения и завышает реальный показатель отказов. Есть специальный инструмент, с помощью которого можно регулярно мониторить URL-адреса и выявлять нерабочие;

 

3) Блокировщики рекламы в браузерах пользователей могут мешать загрузке счетчика Google Analytics так же, как и в случае с Яндекс.Метрикой.

Подсчет конверсий за сеанс

В Google Рекламе можно настроить, как подсчитывать конверсии за сеанс – все («Каждая») или только уникальные («Одна»). Если пользователь выполняет одно и то же целевое действие дважды за сеанс, в первом случае система регистрирует две конверсии, во втором – одну.

 

Система Google Аналитика отдельно рассматривает цели на сайте и транзакции электронной торговли. Каждая цель засчитывается 1 раз за сеанс, а транзакции – по их количеству за сеанс.

Атрибуция по умолчанию

Google Реклама по умолчанию привязывает конверсии к последнему клику, Google Аналитика – за исключением прямых каналов (для всех отчетов, кроме многоканальных последовательностей).

 

Если пользователь перешел по объявлению, а через пару дней открыл сайт из органической выдачи и оформил заявку, Аналитика пометит её как google/organic. Google Реклама отнесет эту заявку к кампании, рекламной группе, объявлению или ключевому слову, которые при этом сработали.

Дата конверсии

По аналогии с Яндексом, в отчетах Google Рекламы фиксируется время клика, в результате которого произошла конверсия, а в Google Аналитике – время, когда непосредственно произошла конверсия.

 

Если пользователь перешел по рекламе вчера, а совершает покупку сегодня, Google Ads засчитает конверсию для вчерашнего дня, а Google Analytics – для сегодняшнего.

Отключение / блокировка файлов cookie пользователем

Если Google Рекламе это не мешает зарегистрировать конверсию, в Google Analytics она не засчитается. Это относится и к другим технологиям, с помощью которых Аналитика отслеживает поведение посетителей сайта.

Звонки-конверсии

В Google Рекламе можно настроить в объявлениях расширения с номером телефона и назначить в качестве цели звонок с определенной длительностью. Это отдельный вид конверсий, который регистрируется только в Google Ads.

Взаимодействие с разных устройств

В Google Analytics данные по действиям-конверсиям показываются, только если клик был с того же устройства, что и конверсия. Google Ads показывает всю цепочку целиком – то есть все устройства, которые в этом участвовали.

Корректировка данных

Данные по кликам, конверсиям и показам в Google Рекламе обновляются, как правило, в течение 3 часов. В Аналитике это может занять до 9 часов.

 

Бывают исключения, когда на обновление статистики в Google Ads уходит один и более дней после клика. Возможная причина: система выявляет недействительный трафик и удаляет его.

Данные рекламных систем и данные Yagla

Показатели могут различаться по следующим причинам.

Клики, не приводящие к подмене контента сайта

Первый случай: после клика пользователь попадает не на сайт, а на виртуальную визитку. Так как подмены не отображаются, клик в Yagla не засчитывается.

 

Второй случай: пользователь переходит по быстрым ссылкам объявления. Так как к ним не прикрепляются UTM-метки сервиса Yagla, клики по ним не приводят отображению подмен, а значит, также не учитываются.

 

Третий случай: технический сбой, в реультате которого подмена не сработала.

Разница в дате запуска

Если вы запустили рекламу и проект в разное время, то и данные могут не совпадать.

Принцип подсчета статистики

Если пользователь дважды кликает на одно и то же объявление в течение 30 минут, Яндекс.Директ засчитывает один клик. Сервис Yagla засчитывает оба клика, так как подмена сработала оба раза. Поэтому в Yagla вы можете видеть большее количество переходов, чем в интерфейсе Директа.

Мобильная версия сайта не размечена

Если вы не сделали разметку мобильной версии страницы в Yagla, но при этом получаете трафик с мобильных устройств, подмены для них отображаться не будут.

 

Заметьте, если посадочная страница не адаптирована для мобайла, то есть и мобильные, и десктопные посетители видят одну и ту же версию, в данном случае сервис Yagla отображает подмены и засчитывает трафик из мобайла.

Корректировка данных

В сервисе Yagla вы видите более актуальную и точную (без округлений) информацию, чем в рекламном кабинете и системе аналитики Яндекса или Google. Это обусловлено тем, что статистика в Yagla выгружается через API Директа или Google Ads.

 

То есть с учетом задержки формирования данных, показатели Яндекс.Директ выравниваются в течение 5 дней, то есть все данные 5-дневной давности по Яндексу должны совпадать с данными в Yagla. Для Google Ads этот период составляет несколько часов – в среднем, 3-5.

Применение моделей атрибуции

Эта причина является следствием предыдущей. Так как в Yagla актуальные данные попадают быстрее, при применении атрибуции учитывается бОльший период.

 

Например, если смотреть статистику за месяц с 1 по 31 (допустим, это сегодняшний день), рекламная система не отразит данные за 31 число в общих показателях, так как она их еще не обработала. В Yagla эти данные зачтутся, несмотря на то, что они неокончательные, а потому подвержены корректировке, которая занимает около 4 дней.

Технические проблемы

Сюда относится всё то же самое, что связано с настройкой и работой счетчиков, плюс если посетитель уходит с сайта до того, как загрузится код Yagla.

 

Таким образом, если вы увидите расхождения в данных, без паники. Дождитесь корректировки данных, проверьте работу счетчиков и не забывайте о том, что рекламная система и система аналитики помогают решать разные задачи. Поэтому вполне логично, что и принципы сбора данных у них разные.

Становясь гуру API Яндекс.Метрики

To-do: Надо что-то сделать с пафосным названием статьи

Если вас интересует использование Logs API Яндекс.Метрики, то рекомендую сначала ознакомиться с текущей статьей, а затем прочитать статью «Становясь падаваном Logs API Яндекс.Метрики».

1. Лирическое отступление

Давно вынашивал идею написать что-то основательное про API Метрики. Взяться за дело меня вдохновила эта статья на хабре, посвященная выгрузке данных с помощью API Яндекс.Метрики. Но в ней, на мой взгляд, все сложновато, зачем создавать инстансы в Amazon, чтобы писать Python-скрипты? Достаточно поставить IPython и будет интерактивное счастье прямо в браузере, с блэкджеком и скаттер-плотами (для тех кто понимает о чем я). Но о том как использовать API Метрики с помощью IPython я напишу когда-нибудь потом, а в этой статье я хотел бы рассказать о том как научиться работать с API и получать данные Метрики в формате CSV с помощью одного запроса через браузер. Один раз скопировать запрос и никакой интерфейс Метрики больше не нужен.

Просто перейдя по ссылке можно выгрузить нужные данные:
https://api-metrika.yandex.ru/stat/v1/data.csv?metrics=ym:s:visits,ym:s:pageviews&dimensions=ym:s:lastTrafficSource&date1=31daysAgo&date2=yesterday&limit=10000&offset=1&ids=2138128&oauth_token=05dd3dd84ff948fdae2bc4fb91f13e22bb1f289ceef0037

Но для начала надо научиться эту ссылку формировать.

С функционалом API Яндекс.Метрики я знаком достаточно давно — с момента выхода второй версии API, которая состоялась одновременно с выходом Метрики 2.0. До этого времени работал только с Google Analytics, так как Яндекс.Метрика в принципе не устраивала своим скудным на тот момент функционалом: я осознавал систему как счетчик веб-статистики, но проделать серьезную аналитическую работу в ней было сложно, разве что с помощью «Конструктора отчетов». Что я подразумеваю под «серьезной» аналитикой? Прежде всего, в моем понимании это построение отчетов с множеством параметров и показателей, а также возможность сегментировать данные по различным критериям. Гигантская проблема заключалась в том, что методы «Констуктора отчетов» не были доступны в первой версии API Метрики, а значит чтобы автоматизировать сбор нужных данных приходилось парсить веб-страницы Метрики, что, мягко говоря, не удобно. Выход нового API стал для компании, в которой я работаю, мощным толчком перейти с использования Google Analytics на Яндекс.Метрику в качестве основной системы веб-аналитики. Причин тут много:

  • Широкая распространенность счетчиков Метрики в рунете
  • Метрика продолжает показывать поисковые запросы, в отличие от Google Analytics
  • Подробная статистика по кампаниям Яндекс.Директа с детализацией до поисковых запросов
  • Как позже оказалось: дружелюбная и достаточно быстрая поддержка (которой я уже, наверно, надоел, но они продолжают героически отвечать)

Миграция с API GA на API Метрики оказалась весьма безболезненной, во многом благодаря тому, что разработчики обеспечили совместимость запросов к Google Analytics Core Reporting API, сделав отдельное совеместимое API. С Core Reporting я был «на ты», поэтому начать пользоваться совместимым API было проще простого.

Если кому интересно про работу с Google Analytics Core Reporting API, то можете ознакомиться с презентацией моего доклада на iMetrics. Чтобы окончательно добить эту тему, по мотивам доклада написал две статьи: первая и вторая. С тех пор интерфейс GA Query Explorer несколько изменился, но изменения больше косметические. Вообще, благодаря Query Explorer работать с API Google Analytics легко. Такого инструмента мне не хватает в Яндекс.Метрике.

Позже оказалось, что совместимое API не содержит всех доступных в Метрике параметров, к тому же в нем периодически попадались неприятные баги, поэтому было решено переходить на использование нативного API Яндекс.Метрики 2.0.

2. Группировки и метрики

Яндекс.Метрика (и её API) оперирует двумя основными сущностями: Dimensions (группировки) и Metrics (метрики). Эта терминология пришла из технологии обработки данных OLAP, она также встречается и в Google Analytics. Благодаря этому, API GA и API Метрики 2.0 очень похожи, и это существенный плюс, потому что начать работать с нативным API Метрики было очень легко, имея опыт работы с API GA.

Группировки/Dimensions (мне их привычнее называть «измерениями», но буду придерживаться терминологии Метрики) — это какой-либо атрибут визита или хита. Как ясно из названия, группировки позволяют группировать данные по определенным признакам.

Примеры группировок: Источник трафик, Город, Браузер, Страница входа.

Группировки — это все те параметры, которые можно найти в одноименном разделе при построении отчета в интерфейсе Метрики:

Метрики/Metrics — это числовые величины, которые связаны с визитом или хитом.

Примеры метрик: количество визитов, показатель отказов, среднее время на сайте.

В интерфейсе метрики представлены в правой части табличных отчетов и их также список также можно настраивать:

3. Пример

Метрики и группировки взаимосвязаны. Чтобы понять эту взаимосвязь можно рассмотреть пример посетителя, совершающего посещение сайта.

Пускай, это единственное посещение за всю историю сайта. Атрибуты посетителя, например, его город, браузер, источник трафик, пол, возвраст, все что удалось определить Яндекс.Метрике — это группировки. Яндекс.Метрика определила, что пользователь: пришел из Москвы, из поисковой системы Яндекс.

  • Значение группировки «Город» для этого посещения будет «Москва»
  • Значение группировки «Источник трафика» — «Переходы из поисковых систем»

В ходе посещения посетитель просматривает 5 страниц в течение 4 минут 40 секунд, тогда:

  • Значение метрики «Просмотры» будет равно 5 страницам
  • Значение метрики «Длительность визита» — 280 секунд
  • Значение метрики «Отказы» будет равно 0%, т. к.
    доля отказов для этого посещения будет равна 0%, т. к. пользователь просмотрел более одной страницы. Общая статистика посещений будет выглядеть так:

Общая статистика — это отчет, в котором отсутствуют группировки. Создав отчет с группировкой «Город» и метриками «Визиты» и «Просмотры» мы получим вот такой отчет:

Добавим группировку «Источник трафика» и отчет станет выглядеть вот так:

А теперь предположим, что пришел второй посетитель, тоже через ПС Яндекс, но из Петербурга. Он просмотрел за свой визит 1 страницу и был на сайте меньше 15 секунд. Такой визит будет считаться отказным, значит:

  • Значение метрики «Просмотры» будет равно 1 странице
  • Значение метрики «Длительность визита» — 0 секунд
  • Значение метрики «Отказы» — 100%

Общая статистика посещений станет такой:

Если мы построим отчет с единственной группировкой «Источник трафика», то отчет будет иметь такие же значения метрик, как и в целом по сайту, т. к. у нас два посетителя, у которых одинаковое значение группировки «Источник трафика» — они оба пришли из поисковых систем, данные по ним сгруппировались:

Теперь изменим группировку отчета на «Город»:

Отчет принимает совершенно другой вид: у нас в нем появились две строки, несущие в себе два диаметрально противополжных факта. Отсюда вывод: правильные группировки помогают увидеть правильную информацию в правильном разрезе. Я считаю это основопологающим принципом веб-аналитики и аналитики данных вообще.

Надеюсь, этот пример дал понимание что такое группировки и метрики.

4. Получение доступа к API

Метрика использует протокол OAuth. Этот протокол позволяет работать с данными Яндекса от лица пользователя Яндекса через приложение, зарегистрированное на Яндексе. Приложение получает доступ к данным пользователя с помощью специального ключа, называемого токеном. Итак, прежде чем начать использовать API Яндекс.Метрики нам нужно создать приложение и получить от имени пользователя OAuth-токен, с помощью которого мы будем делать свои запросы к API.

1: Заходим на страницу https://oauth.yandex.ru/
2: Нажимаем «Зарегистрировать новое приложение»

3: Запоняем поле «Название»
4: Выбираем в разделе права «Яндекс.Метрика» и ставим галочку напротив пункта «Получение статистики, чтение параметров своих и доверенных счетчиков»

5: Нажимаем на ссылку «Подставить URL для разработки» под полем «Callback URL»
6: Нажимаем «Сохранить»

7: На открывшейся странице копируем ID приложения (его также можно скопировать увидеть в URL страницы)

8: Авторизуемся на Яндексе под учеткой пользователя, от имени которого будет работать приложение. (Вы можете получать данные с разных логинов Яндекс.Метрики используя одно и то же приложение, только для этого нужно сначала выдать каждому логину свой токен доступа.)
9: Переходим по URL: https://oauth.yandex.ru/authorize?response_type=token&client_id= (В моем случае URL будет такой: https://oauth.yandex.ru/authorize?response_type=token&client_id=e01d9189ff1544488ae9c9c3dae45b58 и этот URL будет действителен и для вас, и токен вы получите, но лучше создайте свое приложение и укажите свой id)
10: Приложение запросит разрешение на доступ, которое нужно предоставить, нажав «Разрешить»:

11: После чего мы получим токен:

Скопируйте и сохраните его. Этот токен позволит получать данные Яндекс.Метрики для счетчиков того логина, которому вы выдали разрешение на доступ. Срок действия токена большой, если честно даже не знаю насколько большой. Для другого логина нужен будет другой токен, его легко получить перейдя по https://oauth.yandex.ru/authorize?response_type=token&client_id=. Если приложению уже предоставлен доступ, то повторно перейдя по адресу мы снова получим тот же токен, что был выдан ранее.

Открывать доступ к собственноручно созданному приложению — это безопасно, в случае с открытием доступов к стороннему приложению, рекомендую смотреть на уровень доступа к данным. Например, у сторонних приложений, которые строят отчеты по API на основе данных Яндекс.Метрики, не должно быть доступов к редактированию счетчиков. На странице «Управление доступом» в Яндекс.Паспорте можно увидеть каким приложением предоставлен доступ к данным Метрики.

5. Структура запроса к API

Итак, у нас есть токен и теперь мы можем делать запрос. В качестве примера токена я буду использовать тестовый токен, указанный в документации Яндекс.Метрики:
05dd3dd84ff948fdae2bc4fb91f13e22bb1f289ceef0037

В API Метрики есть несколько типов запросов:

  • Таблица
  • Drill down
  • Получение данных по времени
  • Сравнение сегментов
  • Сравнение — drill down

В этой статье я буду рассматривать только запрос «Таблица», т. к. он позволяет в дальнейшем сформировать любые нужные представления данных.

Запрос «Таблица» вытягивает «плоские» табличные данные, тогда как «Drill down» отдает иерархически вложенные друг в друга данные. Эта логика есть и в интерфейсе. Переключитесь между видом «Линейный список» и «Древовидный список»:

Вид «Древовидный список» удобен для анализа данных в интерфейсе: в поиске озарения можно углубляться и углубляться в данные до тех пор пока не кончатся группировки. Вид «линейный список» удобнее для анализа с помощью табличных процессоров (например, Excel) или обработки с помощью SQL-запросов, в датафрейме R или Pandas. Когда группировок много, «плоский» вид данных несомненно выигрывает, так как позволяет быстро манипулировать всеми доступными данными, а иерархический список жестко привязывает нас к заданной иерархии вложенности группировок.

Запрос к API Метрики — это обычный GET-запрос, который можно выполнить из браузера. Этот запрос представляет собой основной URL «https://api-metrika.yandex.ru/stat/v1/data», вопросительный знак «?» и дальше идут параметры запроса, которые перечисляются через знак «&». Параметров запроса много, но я коснусь только основных. Упрощенно структура запроса выглядит так:

https://api-metrika.yandex.ru/stat/v1/data ?
metrics=<string>
& dimensions=<string>
& date1=<string>
& date2=<string>
& limit=<integer>
& offset=<integer>
& ids=<int,int,…>
& oauth_token=<string>

В одну строку это выглядит так: https://api-metrika.yandex.ru/stat/v1/data?metrics=<string>&dimensions=<string>&date1=<string>&date2=<string>&limit=<integer>&offset=<integer>&ids=<int,int,…>&oauth_token=<string>

Обязательными параметрами являются только metrics, oauth_token и ids.

6. Формируем запрос к API

Начнем составление нашего запроса к API

1 — В параметре metrics нужно перечислить список метрик. Они разделяются через запятую. Наименования метрик чувствительны к регистру. Максимальное число метрик в запросе — 20. Со списком метрик уровня визитов можно ознакомиться по ссылке. Чаще всего в отчетах нужны именно эти метрики, поэтому метрики уровня хита (просмотра) я в этой статье рассматривать не буду. Основные из метрик:

  • ym:s:visits — количество визитов
  • ym:s:pageviews — суммарное количество просмотров страниц
  • ym:s:users — количество уникальных посетителей (за отчетный период)
  • ym:s:bounceRate — показатель отказов
  • ym:s:pageDepth — глубина просмотра
  • ym:s:avgVisitDurationSeconds — средняя продолжительность визитов в секундах
  • ym:s:goal<goal_id>reaches — количество достижений цели, где вместо надо подставить идентификатор цели (зайдите в настройки целей для конкретного счетчика, чтобы получить список их идентификаторов)
  • ym:s:sumGoalReachesAny — суммарное количество достижений всех целей

Для тестового запроса выберем метрики «Визиты» (ym:s:visits) и «Просмотры» (ym:s:pageviews):
metrics=ym:s:visits,ym:s:pageviews

2 — В параметре dimensions нужно перечислить список группировок. Группировки — это необязательный параметр и если их не задать, то в отчете будет представлена общая статистика по сайту. Они также как и метрики разделяются запятой, тоже чувствительны к регистру. Максимальное их число — 10 в одном запросе. Со списком группировок уровня визитов можно ознакомиться по ссылке. Группировки более разнообразны чем метрики. Лично я чаще всего сталкиваюсь с тем, что набор метрик в запросе всегда неизменен, а вот группировки применяю самые различные, в зависимости от стоящей задачи. Поэтому я бы порекомендовал подробно ознакомиться со списком доступных группировок.

Вот пример того какие группировки нужны, чтобы построить отчет по поисковым системам с детализацией до запросов и посадочных страниц:

  • ym:s:<attribution>SearchEngine> — поисковая система
  • ym:s:<attribution>SearchPhrase> — поисковый запрос
  • ym:s:startURL — посадочная страница

Для группировки по датам можно добавить параметр ym:s:date.

Мы видим в группировках параметр <attribution&gt. В некоторых группировках нужно задать атрибуцию трафика. Она определяет как сессии пользователей будут привязываться к источнику трафика. Например, если мы поставили атрибуцию по последнему источнику, то к конкретному источнику в отчете будут отнесены сессии посетителей, у которых этот источник был последним. Существует несколько типов атрибуции трафика:

  • first — атрибуция по первому источнику
  • last — атрибуция по последнему источнику
  • prev — атрибуция по предыдущему источнику
  • lastSign — атрибуция по последнему значимому источнику (значимым считается любой источник, отличный от прямых и внутренних переходов).

Атрибуция в группировках задается с помощью параметризации и тут существует два способа:

  • Подставить вместо <attribution> один из типов (first, last или lastSign) (например, …&dimensions = ym:s:lastSignSearchEngine&…)
  • Оставить <attribution> в группировке и добавить в запрос параметр attribution (например …&dimensions = ym:s:<attribution>SearchEngine&attribution=lastSign…)

Для тестового запроса выберем группировку «Источник трафика» (ym:s:referer):
dimensions=ym:s:referer

О чем еще важно знать:

  1. Существует разделение области действия группировок и метрик на «визиты» и «хиты». Это разделение важно учитывать во внимание при запросах к API, нельзя использовать вместе измерения или метрики, которые относятся к разным областям применения. Группировки и метрики, начинающиеся с «ym:s:», имеют область действия «визиты» (s — session), а группировки и метрики, начинающиеся с «ym:pv:» относятся к «хитам» (pv — pageview — просмотр страницы).
  1. Есть группировки, которые могут принимать в определенных случаях пустое значение (null). Например, группировка «поисковая фраза» будет принимать какое-то значение только, когда есть информация о поисковой фразе. Ясно, что если переход был, к примеру, из социальной сети, то поискового запроса там и в помине не будет. Поэтому если группировка стоит первой в перечне, то при получении статистики из API Метрики будут отображены только те данные, где группировка не принимает пустое значение.

3 — date1 — дата начала отчетного периода в формате YYYY-MM-DD (например, 2015-08-31). Кроме абсолютных значений в формате YYYY-MM-DD можно задавать относительные значения:

  • today — сегодняшняя дата
  • yesterday — вчерашняя дата
  • ndaysAgo — n дней назад от сегодняшней даты, где вместо n надо указать количество дней, например 30daysAgo.

Если не задать начальную дату, то применится значение по умолчанию — 6daysAgo (6 дней назад от текущей даты).

Поставим в качестве даты начала отчета 1 января 2015 года:
date1=2015-01-01

4 — date2 — дата окончания отчетного периода в формате YYYY-MM-DD. Формат такой же как у date1. Важно, чтобы date2 не была меньше date1, а так date2 может быть даже в будущем, запрос будет работать.

Конечная дата date2 в нашем отчете будет вчерашним днем:
date2=yesterday

5 — параметр limit — ограничение на количество возвращаемых результатов. По умолчанию — 100, но максимум — 10000. Я чаще всего во всех запросах использую limit=10000, этого хватает для большинства запросов, но бывает, что отчет возвращает больше строк и тогда нам поможет следующий параметр.

В нашем запросе будем получать максимум — 10000 строк:
limit=10000

6 — параметр offset определяет первую строку выборки, значение по умолчанию — 1, что означает, что отчет будет генерироваться с первой строки. Этот параметр полезен, когда отчет содержит больше чем 10000 строк. Предположим, у нас больше 10000 строк. Первым запросом с offset=1 и limit=10000 мы выгрузим первые 10000 строк. Установив offset=10001 мы выгрузим данные, начиная с 10001 строки, при limit=10000 это означает, что будут выгружены строки 10001-20000. Если данных больше, чем 20000, то нужно сделать третий запрос, увеличив offset еще на 10000. И так далее в зависимости от объемов данных.

Устанавливаем первую строку:
offset=1

7 — ids содержит перечень идентификаторов счетчиков. Это поле поддерживает более одного значения, это значит мы можем одним запросом выгружать данные с нескольких счетчиков.

Для нашего тестового запроса возьмем значения ids=2138128,2215573.

Важно помнить, что если мы включаем в отчет данные более чем 1 счетчика, то они будут сгруппированы по тем группировкам, которые мы задали в dimensions. Это означает, что для того, чтобы разделить данные на отдельные сайты нужно передать в отчет какой-то параметр, который будет точно идентифицировать каждый из сайтов, например, добавить группировку «Домен страницы входа» (ym:s:startURLDomain).

Тогда полный список наших группировок будет таким:
dimensions=ym:s:referer,ym:s:startURLDomain

8 — параметр oauth_token — это авторизационный токен. Для каждого пользователя (логина Метрики) должен быть свой токен. Если запросить данные по счетчикам, воспользовавшись другим токеном, не подходящим к пользователю, то запрос возвратит сообщение об ошибке.

Мы будем использовать тестовый токен, указанный в документации:
oauth_token=05dd3dd84ff948fdae2bc4fb91f13e22bb1f289ceef0037

Итак, мы собрали наш запрос по кусочкам и вот что получили:

https://api-metrika.yandex.ru/stat/v1/data?metrics=ym:s:visits,ym:s:pageviews&dimensions=ym:s:referer,ym:s:startURLDomain&date1=2015-01-01&date2=yesterday&limit=10000&offset=1&ids=2138128,2215573&oauth_token=05dd3dd84ff948fdae2bc4fb91f13e22bb1f289ceef0037

7. Выполняем запрос

Теперь вставим запрос в адресную строку браузера и выполним его, перейдя по URL (ну или просто перейдите по ссылке выше).

Получили вот такой ответ:

Не стоит пугаться, это ответ в формате JSON. На самом деле, это крайне удобный формат данных, но пригоден он для использования в программировании, формировании post-запросов на веб-сервера, а вот человеку не очень просто быстро в нем разобраться. Чтобы облегчить эту задачу сделаем JSON более «красивым», добавив к запросу параметр pretty=true:

https://api-metrika.yandex.ru/stat/v1/data?metrics=ym:s:visits,ym:s:pageviews&dimensions=ym:s:referer,ym:s:startURLDomain&date1=2015-01-01&date2=yesterday&limit=10000&offset=1&ids=2138128,2215573&oauth_token=05dd3dd84ff948fdae2bc4fb91f13e22bb1f289ceef0037&pretty=true

Теперь стало чуть более понятно:

Верхушка ответа от API — это параметры нашего запроса (выделена желтым). Тут стоит обратить внимание на параметр dimensions. Это те группировки, что мы указали в своем запросе (выделены красной рамкой). А ниже metrics (выделены синей рамкой):

После перечисления параметров идет ответ от API. Ответ содержится в параметре data, он представлен в виде массива данных, заключенных в квадратные скобки. Этот массив — множество строчек данных, каждая из которых заключена в фигурные скобки. Я обвел один элемент массива оранжевой обводкой — это одна строка данных:

Внутри каждой строки есть dimensions (обведены красным) и metrics (обведены синим). Это значения наших группировок, они указаны в том порядке, в котором идут в параметрах запроса. Значит для этой строки данных:

  • ym:s:referer=«https://google.ru/»
  • ym:s:startURLDomain=«help.yandex.ru»
  • ym:s:visits=57136.0
  • ym:s:pageviews=120931.0

В интерфейсе Метрики эта строчка выглядела бы так:

JSON, как я уже сказал, не самый человекопонятный вид данных, но только в JSON-формате API отдает важный параметр total_rows — общее количество строчек, доступных по заданному запросу. Чтобы найти этот параметр нужно перейти в самый конец страницы:

В нашем случае total_rows = 94629, а это значит, что нам пришлось бы сделать еще 9 запросов, итеративно увеличивая offset на 10000, чтобы выгрузить все данные.

Но оставим JSON разработчикам. Для «обывателей» (надеюсь никто не обидится) Метрика может отдавать данные в CSV. Всё, что для этого нужно — после data в запросе поставить параметр «.csv», тогда URL нашего запроса будет выглядеть так:

https://api-metrika.yandex.ru/stat/v1/data.csv?metrics=ym:s:visits,ym:s:pageviews&dimensions=ym:s:referer,ym:s:startURLDomain&date1=2015-01-01&date2=yesterday&limit=10000&offset=1&ids=2138128,2215573&oauth_token=05dd3dd84ff948fdae2bc4fb91f13e22bb1f289ceef0037 (обратите внимание, что я убрал pretty=true, т. к. для CSV-запроса он не нужен)

После того как мы сделаем запрос по этому URL, загрузится файл data.csv:

Загруженный CSV (Comma-separated values) представляет собой обычный текстовый файл в кодировке UTF-8, где значения разделены запятыми:

Перед нами наши данные в значительно более привычном виде. Сначала идет заголовок таблицы, тут уже нет никаких ym:s:referer и названия группировок и метрик отображаются также как и в интерфейсе. Затем идет строчка с итоговыми данными (по всей выборке, а не только по выгруженным 10000 строкам), а после идут строки с данными. Их 10000. Если мы хотим выгрузить остальное — надо делать ещё запросы (изменяя offset).

8. Импорт в Excel

CSV очень просто загрузить в Excel, воспользовавшись функцией «Получение внешних данных из текста», которая находится в разделе «Данные»:

Сначала указываем путь к данным:

Указываем, что наши данные содержат разделители и задаем кодировку файла UTF-8:

Далее указываем используемый разделитель «запятая» и нажимаем «Готово»:

Помещаем данные на имеющийся или новый лист и вуаля:

9. Заключение

Таким образом, формирование нужных отчетов Яндекс.Метрики, которые будут в несколько кликов доступны для анализа, сводится к тому, чтобы:
а) сделать нужный URL запроса
б) запросить данные через браузер и скачать csv-файл
в) открыть csv-файл в Excel или любом другом табличном процессоре или приложении анализа данных

У запроса даже не нужно менять даты, потому что можно пользоваться такими параметрами: date1=7daysAgo&date2=yesterday. Такой запрос будет выбирать данные за последнюю неделю.

В качестве бонуса приведу некоторые сочетания группировок и метрик, которые могут пригодится. Идентификаторы счетчиков и токен невалидные, вам нужно будет поставить свои, чтобы запросы работали.

Отчет по Директу для поисковых кампаний
https://api-metrika.yandex.ru/stat/v1/data.csv?dimensions=ym:s:directSearchPhrase,ym:s:directClickOrder,ym:s:directBannerGroup,ym:s:directClickBanner,ym:s:directPhraseOrCond,ym:s:UTMSource,ym:s:UTMMedium,ym:s:UTMCampaign,ym:s:UTMContent&metrics=ym:s:visits,ym:s:pageviews,ym:s:bounceRate,ym:s:avgVisitDurationSeconds,ym:s:sumGoalReachesAny&filters=ym:s:directPlatformType==’search’&limit=10000&offset=1&ids=31458&oauth_token=53e1a43ac4af43be73e0ba2c4b&include_undefined=true

Отчет по Директу для кампаний РСЯ
https://api-metrika.yandex.ru/stat/v1/data.csv?dimensions=ym:s:directPlatform,ym:s:directClickOrder,ym:s:directBannerGroup,ym:s:directClickBanner,ym:s:directPhraseOrCond,ym:s:UTMSource,ym:s:UTMMedium,ym:s:UTMCampaign,ym:s:UTMContent&metrics=ym:s:visits,ym:s:pageviews,ym:s:bounceRate,ym:s:avgVisitDurationSeconds,ym:s:sumGoalReachesAny&filters=ym:s:directPlatformType==’context’&limit=10000&offset=1&ids=31458&oauth_token=53e1a43ac4af43be73e0ba2c4b&include_undefined=true

Отчет по ключевым словам из ПС с детализацией по целевым страницам (страницам входа) и статистикой поисковых запросов
https://api-metrika.yandex.ru/stat/v1/data.csv?dimensions=ym:s:lastSearchEngine,ym:s:lastSearchPhrase,ym:s:startURL&metrics=ym:s:visits,ym:s:pageviews,ym:s:bounceRate,ym:s:avgVisitDurationSeconds,ym:s:sumGoalReachesAny&filters=ym:s:lastTrafficSource==’organic’&limit=10000&offset=1&ids=31458&oauth_token=53e1a43ac4af43be73e0ba2c4b&include_undefined=true
(Используется атрибуция last)

Отчет по источникам трафика (каналам), детальным источникам трафика, реферерам и целевым страницам
https://api-metrika.yandex.ru/stat/v1/data.csv?dimensions=ym:s:lastTrafficSource,ym:s:lastSourceEngine,ym:s:referer,ym:s:startURL&metrics=ym:s:visits,ym:s:pageviews,ym:s:bounceRate,ym:s:avgVisitDurationSeconds,ym:s:sumGoalReachesAny&limit=10000&offset=1&ids=31458&oauth_token=53e1a43ac4af43be73e0ba2c4b&include_undefined=true
(Используется атрибуция last)

О чем еще важно помнить:

  • В документации ей всё, ну или почти всё (есть кое-что, что не описано :). Например, есть полный список группировок и метрик
  • Один запрос содержит не более 10 измерений, не более 20 метрик
  • Не все группировки и метрики (одинаково полезны) совместимы (ym:s: и ym:pv:), также нельзя вместе применять некоторые группировки Директа с другими группировками (например, нельзя сделать группировку по часам или по городам, если есть группировка Директа)
  • На одного пользователя (один логин) есть ограничение в 5000 запросов в день

Успехов в автоматизации! Она заставляет поверить, что в мире есть место «магии». А еще даёт возможность убить тупую рутину и больше времени посвящать размышлениям и творчеству 🙂

Вступайте в группу на Facebook и подписывайтесь на мой канал в Telegram, там публикуются интересные статьи про анализ данных и не только.

как это работает, и как вывести с него трафик

Этой статьей мы начинаем международную серию статей по SEO, которые будут охватывать поисковые системы, популярные в странах, где Google НЕ лидирует.

На этой неделе все готово и закрывается Яндекс — поисковая система номер 1 в России. Около 62% всех поисковых запросов в русскоязычном сегменте Интернета происходит на Яндексе (против 26,5% из них — в Google).

Помимо России, Яндекс также является популярной поисковой системой в Украине, Казахстане, Беларуси и — теперь тоже — в Турции.

Итак, если вы хотите подключиться к этой поисковой системе, которая получает более 100 миллионов кликов ежедневно, но не знаете, с чего начать — читайте дальше, этот пост для вас!

Почему Яндекс похож на Google

Во многих отношениях поиск Яндекса на удивление похож на Google, хотя первый построен на другом языке. Вот что я имею в виду:

Яндекс.Карты похожи на Google Maps

Яндекс.Переводчик похож на Google Translate

Яндекс.Деньги похожи на Google Кошелек

Яндекс.Браузер — это Яндекс.версия Google Chrome

Яндекс.Маркет напоминает один из Google Shopping

Яндекс.Почта похожа на Gmail

Яндекс также имеет изображения (хотя Яндекс.Фотки работает немного больше, чем Flickr ), видео и другие поисковые вертикали.

И Яндекс только что запустил Яндекс.Острова, которые, похоже, являются поисковой системой , обеспечивающей немедленных ответов (аналогично тому, как это делает сеть знаний Google ).

Яндекс SEO

SEO для Яндекса выглядит довольно уникальным из-за своей своеобразной терминологии (у Яндекса нет PageRank, но есть тематический индекс цитирования — метрика, по сути похожая на PageRank).

На самом деле, однако, он не сильно отличается от Google или Bing SEO, но, конечно, нужно либо знать язык, либо нанять кого-то, кто знаком с ним, чтобы успешно продвигать свой сайт в русскоязычных результатах поиска Яндекса.

Итак, если вы полны решимости попытаться повысить рейтинг своего веб-ресурса в Яндексе, вот с чего начать:

Яндекс.Вебмастер (перейти на английский в футере)

Это бесплатный сервис, который оценивает сайт на доступность, возможность сканирования, географическую релевантность и другие параметры. Яндекс.Вебмастер также позволяет указать физический адрес, с которым должен быть связан онлайн-бизнес, чтобы бизнес появился на Яндекс.Картах.

Советы веб-мастерам

Это рекомендации Яндекса относительно лучших практик, которых следует придерживаться, чтобы их веб-сайт хорошо работал на Яндексе.

Определение веб-спама Яндексом

Яндекс определяет веб-спам аналогично Google. Запрещается использовать крошечный или невидимый текст на странице, встраивать невидимые ссылки, создавать дорвеи или страницы или пытаться манипулировать тематическим индексом цитирования своего сайта.

Как и Google, Яндекс нанимает людей оценщиков , которые проверяют качество поиска и предоставляют данные для системы машинного обучения Яндекса под названием MatrixNet.

Яндекс.Метрика

Яндекс.Метрика — аналог Google Analytics Яндекс. Он позволяет просматривать статистику трафика (просмотры страниц, показатели отказов, время на сайте и т. Д.), Демографические данные посетителей сайта, статистику ключевых слов (предоставляется!), Пути перехода и многое другое.

Статистика по ключевым словам Яндекса

У

Яндекс есть собственный инструмент подсказки ключевых слов, который позволяет узнать, сколько показов в месяц вы получите, если используете запрос в качестве одного из ключевых слов. Фильтр « По региону, » позволяет просматривать статистику по разным регионам, а вкладка « История запросов, » показывает, как популярность ключевого слова менялась с течением времени.

Важные обновления Яндекса

В отличие от Google, Яндекс не может похвастаться множеством обновлений на тему животных, таких как Google Penguin или Google Panda. Однако за эти годы был внесен ряд изменений, которые сильно повлияли на поиск Яндекс.

Внедрение MatrixNet в 2009 году изменило алгоритм ранжирования Яндекс. MatrixNet — это метод машинного обучения (аналогичный алгоритму Google Panda), который позволяет Яндексу предоставлять поисковикам более релевантные результаты, используя меньше ресурсов.

Еще одно (недавнее) важное обновление: Яндекс отбрасывает обратные ссылки в качестве фактора ранжирования (официально реализовано 12 марта -го , 2014) для коммерческих запросов . Пока что изменение затрагивает ограниченный круг коммерческих поисковых запросов и только в Московской области.

Однако Яндекс может исключить обратную ссылку из уравнения для более широкого диапазона поисковых запросов в большем количестве регионов в будущем. Этот шаг призван уничтожить существующие сети ссылок, сайты брокерских ссылок и другие подобные ресурсы, которые оптимизаторы поисковых систем Яндекса использовали для манипулирования тематическими индексами цитирования своих сайтов.

Полезная информация

Эти 2 факта также полезно знать в отношении SEO Яндекса:

1. Яндекс имеет отдельных алгоритмов ранжирования для сайтов в пределах доменной зоны .ru и за пределами из нее:

2. Как и другие основные поисковые системы, Яндекс поддерживает тег noindex , тег nofollow и канонический тег URL. Он также будет соблюдать инструкции в роботах .txt файл.

Платный поиск Яндекса

По состоянию на 2014 год большую часть доходов Яндекс получает от контекстной рекламы, доля Яндекса на российском рынке контекстной рекламы в настоящее время оценивается в 78%.

Контекстная реклама на Яндексе включает поисковую рекламу и контентную рекламу .

Яндекс.Директ — это сервис, аналогичный Google AdWords, который позволяет размещать оба типа объявлений: поисковых объявлений и контентных объявлений .

Цена модели — плата за клик (PPC)

Минимальная сумма заказа — 10

долларов США

Помимо участия в Яндекс.Директе, можно также разместить таргетированных баннеров через Медиа и контекстную баннерную рекламу, которая будет отображаться в Яндекс.Поиске и в других сервисах Яндекса (Домашняя страница Яндекса, Яндекс.Почта, Яндекс.Новости, Яндекс.Словари , так далее.).

Модель ценообразования — цена за тысячу показов (CPM) = стоимость за 1000 показов

Минимальная сумма заказа — $ 574,08

Всего, по оценкам, рекламу Яндекса будут показывать более 37 млн ​​человек ежедневно.Итак, если вы подумываете о платной рекламе на Яндексе, это то, сколько вы потенциально можете получить — в зависимости от вашего бюджета, конечно.

С чего начать

Если у вас нет времени разбираться в требованиях Яндекса к рекламе, ценах и другой документации, вы можете связаться с менеджером аккаунта Яндекс.Директа через краткую онлайн-форму и получить помощь в настройке вашей первой рекламной кампании.

Кроме того, Яндекс составил список из 10 наиболее часто задаваемых вопросов о Яндекс Рекламе.

Между прочим, совсем недавно Яндекс заключил партнерское соглашение с Google, чтобы начать интеграцию платформ ставок в реальном времени обеих компаний: системы RTB Яндекса и DoubleClick от Google. Партнерство сейчас касается только медийной рекламы, но это хорошее начало.

Объединенный проект был запущен в феврале 2014 года, но ожидается, что техническая интеграция будет завершена в течение нескольких месяцев. Новая платформа предоставит рекламодателям Google доступ к контекстно-медийной сети Яндекса и наоборот.

Заключение

В целом, продвижение вашего веб-сайта в обычных результатах поиска Яндекса или в платном поиске — не такая уж большая задача для нероссийского маркетолога. Основным препятствием, с которым можно столкнуться, вероятно, станет язык. Но благодаря недавнему партнерству Google с Яндексом в области ставок в реальном времени, теперь можно получить более легкий доступ к ресурсам Яндекса.

Итак, если вы хотите использовать Яндекс, чтобы расширить присутствие своего бизнеса на карте виртуального мира, используйте для начала ресурсы, представленные в этом посте.

Хотите исследовать больше международных рынков SEO? Следите за новостями о Baidu, Naver и Seznam.

Yandex N.V. Analytics — Трафик, статистика и отслеживание конкурентов


http://ir.yandex.com

Яндекс Н.V. Компания Intro

На сайте Investor Relations размещена информация о бизнесе Yandex N.V. для акционеров, потенциальных инвесторов и финансовых аналитиков.


Промышленность

Услуги связи


Яндекс Н.V. Штаб-квартира

Бульвар Схипхол 165
Схипхол, 1118 BG
Нидерланды



Yandex N.V. Цена акции
17 мар 2021 г., 03:02 GMT

69 долларов.21 год

↓ -0,32 (-0,46%)


Яндекс Н.В. Рыночная капитализация

РЕЙТИНГ WMC
2021

Яндекс Н.В. # 9

Интернет-контент и информация

ALLUnited KingdomUnited StatesCanadaBermudaSwitzerlandIrelandNetherlandsGermanyChinaIsraelSwedenIndiaTaiwanBrazilUruguayLuxembourgAustraliaArgentinaHong KongJerseyMonacoGreeceFranceCyprusCayman IslandsSingaporeBelgiumKazakhstanMaltaRussiaPeruIndonesiaJapanItalyDenmarkMexicoSouth AfricaNorwaySouth KoreaTurkeySpainLithuaniaChannel IslandsUnited Arab EmiratesCzech RepublicAustriaIsle из ManGeorgiaGibraltar


Оценка рынка WMC


Рейтинг WMC от рынка к выручке


Яндекс Н.V. Market Financials

Выберите валюту TypeAEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBNDBOBBRLBSDBWPBYNBZDCADCDFCHFCLPCNYCOPCRCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDGBPGELGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSINRIQDIRRISKJMDJODJPYKESKGSKHRKMFKRWKWDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSLLSOSSRDSSPSTNSVCSYPSZLTHBTJSTMTTNDTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMW


Выручка, расходы, прибыль


юаней
руб. 198 441 000 ₽ 108 966 000 ₽ 25 650 000 ₽ ₽251 170 млрд 9
долларов США 166 030 000 долл. США 57 104 000 долл. США 31 534 000 долл. США $ 0 трлн. 1
долларов США 73 357 000 долл. США 33 382 000 долл. США 20 958 000 долл. США $ 7 952 970 млрд 2
105 543 000 иен 35 610 000 иен 3 515 000 иен 897 980 млрд йен 3
евро 7 323 000 евро € 2 073 000 € -323 000 € 541 520 млрд 4

Аналитика рынка


Поиск компаний по сравнению с четырьмя ведущими отраслевыми конкурентами



Итого Яндекс Н.Последователи в социальных сетях и 4 ведущих отраслевых конкурента



Yandex N.V. Post и 4 ведущих отраслевых конкурента




Цифровой след Yandex N.V. по размеру в сравнении с 4 ведущими отраслевыми конкурентами



Цифровой след Yandex N.V. по темпам изменений в сравнении с 4 ведущими отраслевыми конкурентами



Яндекс Н.V. Расчет рыночной оценки WMC


1,64 0 0 0 0 0 0.13
100 0 0 36 0 0 16,81
44,18 100 16.88 100 0 0 100
9,78 0 0 2 0 0 0.89
5,25 79,07 100 1 0 0 83,16

Закажите бесплатную личную демонстрацию с одним из наших сотрудников и узнайте, как платформа бизнес-аналитики WMC может помочь вам защитить и увеличить доход.

Нашу платформу любят и доверяют


ведущих мировых брендов Отрасли промышленности

Россия — территория Яндекса | эффективный мир Group

Благодарим вас за интерес к нашему сайту. Мы придаем большое значение защите вашей конфиденциальности при обработке персональных данных, а также безопасности всех бизнес-данных и учитываем это в наших бизнес-процессах.Здесь мы предоставляем вам подробную информацию о том, как обрабатываются ваши данные.

Раздел 1 Информация о сборе персональных данных

(1) Ниже мы сообщаем вам о сборе личных данных при использовании вами нашего веб-сайта. Персональные данные — это все данные, которые могут иметь отношение к вам лично, например имя, адрес, адреса электронной почты, поведение пользователя.

(2) Контроллер в соответствии со ст.4 п. 7 Общий регламент ЕС по защите данных (GDPR) —

Effective GmbH

L13, 3-4

68161 Мангейм

Германия

Управляющий директор: Герман Барейс

Тел .: Телефон +49 621 17893 0

Эл. Почта: [email protected]

См. Также наше официальное уведомление.

С нашим сотрудником по защите данных можно связаться по адресу [email protected] или по нашему почтовому адресу. Добавьте к нему «Сотрудник по защите данных».

(3) Если мы используем поставщиков услуг для отдельных функций нашего сайта или хотели бы использовать ваши данные в рекламных или других целях или передать их третьим лицам, мы предоставляем подробную информацию для каждого случая ниже.

Раздел 2 Ваши права

(1) Ниже мы разъясняем ваши права как субъекта данных в соответствии со статьей 15 GDPR. Вы можете воспользоваться этими правами в любое время и связаться с нами напрямую по этой причине.Если вы заявите о своих правах против нас, мы тщательно изучим их с учетом соответствующих законодательных требований. Для этого нам может потребоваться запросить дополнительную информацию. Мы подробно объясним вам результаты нашей проверки и действия, которые мы предприняли для выполнения вашего запроса. Вполне возможно, что мы не сможем полностью выполнить ваши пожелания так, как вы хотите. Это не должно мешать вам отстаивать свои права против нас или задавать нам вопросы по этому поводу.Будем рады ответить на все ваши вопросы.

(2) Право доступа

Вы имеете право в любое время получить информацию о том, обрабатываем ли мы ваши персональные данные и какие персональные данные, касающиеся вас, мы обрабатываем. Сюда также входит информация о цели обработки, где это применимо, о получателях, которым были раскрыты данные, о планируемом периоде хранения, где применимо, информация о происхождении этих данных, если мы не получили ее напрямую от вас.Вы также имеете право на бесплатное хранение одной копии ваших личных данных. За выпуск дополнительных копий мы оставляем за собой право взимать разумную административную плату.

(3) Право на исправление

Вы имеете право потребовать, чтобы мы исправили любые неверные данные, которые мы сохранили о вас. Это также включает право требовать дополнения неполных личных данных.

(4) Право на стирание

Вы имеете право потребовать, чтобы мы удалили (удалили) данные, которые мы сохранили о вас.Если мы опубликовали данные о вас, наши обязательства в контексте «права на забвение» в соответствии со статьей 17 (2) GDPR также включают, с учетом доступных технологий и стоимости внедрения, все ссылки на эти данные и все копии и репликации, касающиеся этих данных, и пересылка вашего запроса на удаление другим контроллерам, ответственным за обработку этих опубликованных персональных данных.

(5) Право на ограничение обработки

Вы имеете право потребовать, чтобы мы ограничили обработку данных о вас, которые мы сохранили.После этого любая обработка этих данных будет возможна только с вашего согласия или для некоторых установленных законом целей.

(6) Право на возражение против обработки

Если мы основываем обработку ваших персональных данных на оценке наших законных интересов, вы можете возразить против обработки. Это тот случай, если обработка, в частности, не требуется для выполнения контракта с вами, что объясняется нами в каждом случае в следующем описании функций.Когда вы пользуетесь правом на такое возражение, мы просим вас объяснить причины, по которым мы не должны обрабатывать ваши личные данные так, как это делаем мы. Когда мы получим ваше возражение с указанием причин, мы изучим ситуацию и либо остановим, либо скорректируем обработку данных, либо объясним вам наши веские законные основания для продолжения обработки.

Вы, конечно, можете возражать против обработки ваших личных данных в рекламных целях и в целях анализа данных. Вы можете сообщить нам о своем возражении против обработки в рекламных целях, используя контактную информацию в соответствии с Разделом 1 (2).

(7) Право отозвать согласие в соответствии с законом о защите данных

Если вы дали согласие на обработку ваших данных, вы можете отозвать свое согласие в любое время. Любой такой отзыв согласия применяется к обработке ваших личных данных после того, как вы направили нам уведомление об отзыве.

(8) Право на переносимость данных

Вы имеете право получать от нас персональные данные, касающиеся вас, которые вы нам предоставили, в структурированном, широко используемом и машиночитаемом формате с целью передачи другому контроллеру.Это также включает, по вашему запросу и с учетом доступных технических возможностей, прямую передачу от нас другому контроллеру.

(9) Право на подачу жалобы в надзорный орган

Вы имеете право в любое время подать жалобу в надзорный орган по защите данных в отношении обработки нами ваших личных данных.

Раздел 3 Сбор персональных данных при посещении нашего сайта

(1) Когда вы используете наш веб-сайт исключительно в информационных целях, т.е.е. если вы не зарегистрируетесь или не предоставите нам какую-либо другую информацию, мы будем собирать только те личные данные, которые ваш браузер отправляет на наш сервер. Если вы хотите просмотреть наш веб-сайт, мы будем собирать следующие данные, которые требуются нам по техническим причинам для отображения нашего веб-сайта для вас и обеспечения стабильности и безопасности (правовая основа для этого предусмотрена статьей 6 (1) ( f) GDPR):

.

  • IP-адрес
  • Имя хоста
  • Дата и время запроса
  • Разница часовых поясов относительно среднего времени по Гринвичу (GMT)
  • Содержание запроса (конкретная страница)
  • Статус доступа / код статуса HTTP
  • Объем переданных данных
  • Веб-сайт, с которого пришел запрос (реферер)
  • Конкретные страницы нашего веб-сайта, к которым вы обращались
  • Браузер: тип, версия и языковые настройки
  • Операционная система: Тип и версия
  • Если JavaScript активирован, также:
    • Разрешение экрана
    • Глубина цвета
    • Размер окна браузера
    • Установленные плагины браузера

(2) В дополнение к вышеуказанным данным, когда вы используете наш веб-сайт, файлы cookie будут сохраняться на вашем компьютере.Файлы cookie — это небольшие текстовые файлы, которые хранятся на вашем жестком диске, выделяются используемому вами браузеру и через которые определенная информация отправляется в тело, которое размещает cookie (здесь мы). Файлы cookie не могут запускать какие-либо программы или передавать вирусы на ваш компьютер. Они служат для того, чтобы сделать веб-сайт в целом более удобным и эффективным.

(3) Использование файлов cookie:

a) Этот веб-сайт устанавливает следующие файлы cookie на вашем устройстве напрямую или через внешние источники:

Имя

Тип

Назначение / источник

Срок службы

_gat_UA- […]

Статистический

Используется Google Analytics для ограничения частоты запросов.

Установлено Effective-world.com.

1 минута

_ga

Статистический

Регистрирует уникальный идентификатор, который используется для генерации статистической информации о том, как вы используете сайт.

Установлено Effective-world.com.

2 года

_gid

Статистический

Регистрирует уникальный идентификатор, который используется для генерации статистической информации о том, как вы используете сайт.

Установлено Effective-world.com.

1 день

PHPSESSID

Необходимо

Используется для управления посещением нашего веб-сайта в технических целях во время текущего сеанса браузера.

Установлено Effective-world.com.

Конец сеанса

cookie_overlay

Необходимо

Используется для отображения и управления уведомлением о файлах cookie.

Установлено Effective-world.com.

Конец сеанса

б) Мы также используем объекты хранения HTML5 в объеме, необходимом для технических целей, которые хранятся на вашем устройстве.

c) Вы можете настроить параметры своего браузера по своему усмотрению и, например, отказаться от приема сторонних файлов cookie или всех файлов cookie. Обратите внимание, что в этом случае вы не сможете использовать все функции этого веб-сайта.

Обычно мы рекомендуем вам удалять файлы cookie и историю вашего браузера автоматически или вручную через определенные промежутки времени, чтобы повысить защиту вашей конфиденциальности.

Раздел 4 Другие функции и предложения нашего веб-сайта

(1) Помимо использования нашего веб-сайта исключительно в информационных целях, мы также предлагаем ряд услуг, которыми вы можете воспользоваться, если хотите. Для этого вам обычно необходимо предоставить дополнительные персональные данные, которые мы используем для предоставления соответствующих услуг и к которым применяются вышеуказанные принципы обработки данных.Обязательные поля помечены звездочкой. Ввод информации в поля, не отмеченные звездочкой, осуществляется исключительно на добровольной основе.

(2) Когда вы связываетесь с нами по электронной почте или через контактную форму, ваш адрес электронной почты и другие данные, которые вы нам предоставляете, будут сохранены нами для ответа на ваш запрос. Если между нами существуют коммерческие отношения или если такие отношения устанавливаются в результате вашего запроса, мы будем хранить эти данные в течение всего срока наших коммерческих отношений.В противном случае мы удалим эти данные после того, как хранение больше не потребуется для полной обработки вашего запроса. Если существуют установленные законом периоды хранения, которые не позволяют нам удалять данные, мы ограничиваем обработку ваших данных на время этих периодов хранения, а затем удаляем данные. При обращении к нам через контактную форму обратите внимание на обязательные поля, как описано в параграфе 1, чтобы вы случайно не отправили личные данные, которые не требуются. Отправляя контактную форму или свое электронное письмо, вы даете согласие на обработку данных, которые вы отправили таким образом (правовая основа: статья 6 (1) (a) GDPR).

(3) В некоторых случаях мы будем использовать внешних поставщиков услуг для обработки ваших данных. Они были тщательно отобраны и введены нами в эксплуатацию, должны следовать нашим инструкциям и регулярно контролируются.

(4) Если наш поставщик услуг или партнер находится в стране за пределами Европейской экономической зоны (ЕЭЗ), мы проинформируем вас о последствиях этого обстоятельства в описании предложения.

Особые виды использования

1.Использование наших порталов для приема на работу

(1) На нашем веб-сайте у вас есть возможность подать онлайн-заявку на вакансию или стажировку, предлагаемую нами. В своем онлайн-заявлении вы предоставите нам личные данные. Мы придаем большое значение тому, чтобы ваши личные данные обрабатывались конфиденциально в процессе подачи заявки. Таким образом, все личные данные, которые вы нам доверяете, будут обрабатываться строго конфиденциально и ответственно в соответствии с применимыми нормативными положениями о защите данных.Мы применяем технические и организационные меры безопасности для защиты ваших данных от случайных или преднамеренных манипуляций, потери, уничтожения или доступа посторонних лиц. Когда личные данные собираются и обрабатываются, информация передается в зашифрованной форме TLS, чтобы предотвратить любое неправомерное использование данных третьими лицами. Правовой основой для обработки персональных данных, которые вы предоставляете нам при подаче заявки, является то, что ваши данные необходимы для шагов до заключения договора в соответствии со статьей 6 (1) (b) GDPR.Если данные, представленные вами для целей заявки, также включают особо конфиденциальные специальные категории данных в соответствии со статьей 9 (1) GDPR, эти данные будут обрабатываться нами на законной основе вашего согласия в соответствии со статьей 6 (1) (a). , который мы должны получить от вас по этой причине, как указано в пункте 3.

(2) Если вы хотите подать онлайн-заявку на работу или стажировку, вам нужно будет ввести определенные личные данные, отмеченные как обязательные поля в соответствующей онлайн-форме, например.грамм. фамилия, имя и адрес электронной почты. Чтобы нам было проще связаться с вами, вы также можете добровольно ввести дополнительные контактные данные, в частности, номер стационарного и мобильного телефона. Чтобы мы могли лучше удовлетворить потребности вашего приложения, вы также можете добровольно отправлять нам дополнительные данные и файлы, например личное сообщение, информация о вашей профессиональной квалификации и опыте, а также файлы с документами для подачи заявки, такие как личное письмо, резюме, фото заявки, рекомендации и т. д.Обратите внимание, что, в частности, резюме, рекомендации или другие файлы, отправленные вами для подачи заявки, также могут содержать особо конфиденциальные данные, такие как информация о вашей расе или этническом происхождении, политических взглядах, религиозных или философских убеждениях, членстве в профсоюзе или политической партии. , о вашем физическом или психическом здоровье или о вашей сексуальной жизни.Обратите внимание, что, в частности, резюме, рекомендации или другие файлы, отправленные вами для целей подачи заявки, также могут содержать особо конфиденциальные данные, такие как информация о вашей расе или этническом происхождении, политических взглядах, религиозные или философские убеждения, членство в профсоюзе или политической партии, о вашем физическом или психическом здоровье или о вашей сексуальной жизни.Поэтому мы рекомендуем вам, насколько это возможно, не раскрывать какие-либо конфиденциальные данные особых категорий.

(3) Нельзя исключать и в некоторых случаях также необходимо, чтобы вы предоставили нам особые категории данных в своем заявлении, как указано в параграфе 2. Закон запрещает нам обрабатывать такие данные без вашего согласия. Таким образом, данные, которые вы вводите в онлайн-форму заявки, и загруженные файлы будут отправлены нам только в том случае, если вы заявили, установив соответствующий флажок, что вы соглашаетесь на обработку этих конфиденциальных данных особых категорий в соответствии с настоящей Политикой конфиденциальности.К сожалению, без этого согласия вы не сможете использовать наш портал приложений.

(4) Данные и файлы, которые вы отправляете, будут храниться и использоваться исключительно для целей, связанных с записью и обработкой вашего интереса к работе или стажировке в нашей компании и обработкой вашего онлайн-заявки, включая связь с вами для этой цели. Ваше приложение будет рассматриваться как конфиденциальное, и только уполномоченные сотрудники эффективной World Group будут иметь к нему доступ.Если ваша заявка будет успешной, отправленные вами данные и файлы могут быть использованы в трудовых отношениях с вами. Если ваше заявление о приеме на работу не будет успешным, мы будем хранить данные и файлы, отправленные вами, в течение 4 месяцев в нашей базе данных соискателей, чтобы мы могли ответить на любые вопросы, касающиеся вашего заявления. По истечении этого времени данные и файлы будут удалены автоматически. Если вы дали согласие на включение в наш пул кандидатов, чтобы представленные вами данные также могли быть рассмотрены для других вакантных должностей, ваши данные и файлы будут храниться в базе данных кандидатов в течение 12 месяцев и автоматически удаляться по истечении этого времени.

(5) Ваши данные и файлы, представленные в онлайн-заявке, не будут переданы третьим лицам, если вы не дали свое явное согласие или мы не обязаны это делать по административному распоряжению. Ваши данные передаются другим компаниям в Effective World Group только с вашего согласия.

(6) Вы можете отозвать свою заявку в любое время полностью или частично. Вы также можете в любое время запросить удаление или изменение всех или некоторых данных и файлов, представленных вами, из нашей базы данных кандидатов.Вы также имеете право отозвать свое согласие на обработку особых категорий персональных данных, которые вы отправили в контексте онлайн-заявки, или на пересылку документов вашего заявки другим компаниям в рамках действующей мировой группы в любое время с вступлением в силу для будущее. Для этого вам нужно всего лишь отправить электронное письмо на адрес карьеры@effective-world.com. Однако некоторые данные, относящиеся к вашему заявлению, должны храниться в течение ограниченного периода времени в 4 месяца, чтобы соответствовать требованиям законодательства, в частности, обязательству предоставить доказательства в соответствии с Общим законом о равном обращении (Allgemeines Gleichbehandlungsgesetz, AGG).Что касается ваших основных прав, см. Раздел 2 настоящей Политики конфиденциальности.

Веб-аналитика

Правовая основа для использования всех инструментов веб-анализа, перечисленных в этом разделе, обеспечивается статьей 6 (1) (f) GDPR, т.е.защита наших законных интересов с учетом интересов посетителей нашего веб-сайта. Наш интерес заключается в анализе использования нашего веб-сайта его посетителями и использовании статистических данных, полученных в результате этого, для улучшения нашего предложения и повышения его интереса для вас как пользователя.Если используемый инструмент анализа также служит другим целям или если мы используем его для других наших интересов, мы сообщим вам об этом непосредственно в описании соответствующего инструмента анализа.

1. Использование Google Analytics

(1) Этот веб-сайт использует Google Analytics, службу веб-анализа, предоставляемую Google Inc. («Google»). Google Analytics использует «куки», текстовые файлы, которые хранятся на ваших компьютерах и позволяют анализировать использование веб-сайта.Информация, полученная с помощью файлов cookie об использовании вами этого веб-сайта, будет передаваться и храниться на сервере Google в США. Однако в случае активации анонимности IP на этом веб-сайте ваш IP-адрес будет заранее сокращен в государствах-членах Европейского Союза или в других государствах, подписавших Соглашение о Европейском экономическом пространстве. Только в исключительных случаях полный IP-адрес будет передан на сервер Google в США, где он будет сокращен. Google будет использовать эту информацию от имени оператора этого веб-сайта для анализа вашего использования веб-сайта, для составления отчетов о деятельности веб-сайта и предоставления дополнительных услуг, связанных с использованием веб-сайта и Интернета для оператора веб-сайта.

(2) Вы можете запретить сохранение файлов cookie с помощью соответствующих настроек в программном обеспечении вашего браузера; Однако мы отмечаем, что в этом случае вы не сможете в полной мере использовать все функции этого веб-сайта. Вы также можете предотвратить сбор и обработку данных, сгенерированных cookie-файлами и относящихся к использованию вами веб-сайта (включая ваш IP-адрес), путем загрузки и установки подключаемого модуля браузера, доступного по ссылке: https://tools.google.com / dlpage / gaoptout? hl = ru.Кроме того, вы можете использовать эту ссылку, чтобы установить файл cookie отказа, который предотвратит сбор вашей информации при будущих посещениях этого сайта. Обратите внимание, что после удаления файлов cookie, хранящихся на вашем устройстве, вам придется снова установить этот файл cookie, чтобы предотвратить сбор ваших данных на этом сайте.

(3) Этот веб-сайт использует Google Analytics с функцией анонимности. В результате IP-адреса обрабатываются только в сокращенной форме, чтобы предотвратить ссылку на физическое лицо.

(4) В исключительных случаях, когда персональные данные передаются в США, Google соблюдает требования Privacy Shield между ЕС и США, https://www.privacyshield.gov/EU-US-Framework.

(5) Информация о стороннем поставщике: Google Ireland Ltd., Gordon House, Barrow Street, Dublin 4, Ireland
Общая политика конфиденциальности: https://www.google.de/intl/de/policies/privacy и https://www.google.com/policies/privacy/partners/?hl=en

Специальная информация о конфиденциальности для Google Analytics: https: // support.google.com/analytics/answer/6004245?hl=de&ref_topic=2919631

Google LLC, материнская компания Google Ireland Ltd, соблюдает правила обмена конфиденциальной информацией между ЕС и США: https://www.privacyshield.gov/EU-US-Framework

Социальные сети и другие сторонние услуги

1. Социальные сети

(1) В настоящее время мы не используем плагины от поставщиков социальных сетей на нашем веб-сайте, но предоставили ссылки на наши профили со следующими поставщиками социальных сетей: Facebook, LinkedIn.Эти ссылки сами по себе не передают личные данные этим поставщикам. Поставщик получает доступ к вашим личным данным только в том случае, если вы нажимаете на ссылку, которая отображается со значком поставщика социальных сетей, и тем самым получаете доступ к нашей странице, размещенной этим поставщиком.

(2) Согласно решению Европейского суда по делу C-210/16, мы несем ответственность в соответствии с законом о защите данных как оператор нашей фан-страницы, размещенной на Facebook вместе с Facebook, за обработку персональных данных, собранных, когда наш Facebook фан-страница посещена.Поэтому мы предоставляем здесь соответствующую информацию о конфиденциальности. Пожалуйста, прочтите эту информацию, если вы хотите посетить нашу фан-страницу в Facebook. Поскольку обоснование решения может также относиться к другим поставщикам социальных сетей, наша Политика конфиденциальности также включает информацию о других наших профилях. Наша Политика конфиденциальности также включает ссылки на политики конфиденциальности поставщиков социальных сетей.

(3) Кроме того, мы предоставляем вам возможность делиться контентом с нашего веб-сайта только в вашей учетной записи в социальных сетях со ссылками.Для этого мы используем веб-интерфейсы, предоставляемые поставщиками социальных сетей. Когда вы нажимаете на ссылку, помимо указанного нами содержимого, данные, перечисленные в Разделе 3 этого уведомления о защите данных, отправляются соответствующему поставщику социальных сетей, а вы перенаправляетесь на веб-сайт поставщика. Чтобы поделиться контентом, вы должны сначала войти в свою учетную запись в социальной сети или уже должны быть авторизованы. Отправленные данные будут связаны с вашим профилем в социальной сети и использоваться поставщиком в своих целях.Мы не знаем, используются ли эти данные и в какой степени, в том числе когда вы не авторизованы на сайте социальной сети. Эти ссылки сами по себе не передают личные данные этим поставщикам. Поставщик получает доступ к вашим личным данным только в том случае, если вы нажимаете на ссылку, которая отображается со значком поставщика социальных сетей, и тем самым используете функцию обмена.

(4) Адреса соответствующих поставщиков социальных сетей и URL-адреса с их политиками конфиденциальности:

а) Facebook Inc., 1601 S California Ave, Пало-Альто, Калифорния 94304, США; https://www.facebook.com/policy.php; дополнительная информация о сборе данных: https://www.facebook.com/help/186325668085084, https://www.facebook.com/about/privacy/your-info-on-other#applications и https: // www. facebook.com/about/privacy/your-info#everyoneinfo. Google соблюдает правила обмена конфиденциальной информацией между ЕС и США, https://www.privacyshield.gov/EU-US-Framework.

b) LinkedIn Corporation, 2029 Stierlin Court, Mountain View, California 94043, USA; https: // www.linkedin.com/legal/privacy-policy. LinkedIn соблюдает правила обмена конфиденциальной информацией между ЕС и США https://www.privacyshield.gov/EU-US-Framework.

2. Интеграция Google reCAPTCHA

(1) Этот веб-сайт использует Google reCAPTCHA. Мы используем эту услугу, чтобы защитить себя от неправомерного использования наших контактных форм ботами. Правовая основа для использования подключаемого модуля обеспечивается статьей 6 (1) (f) GDPR.

(2) Подключаемый модуль Google reCAPTCHA на наших веб-страницах используется для различения ботов (автоматизированных программ) и людей.Для этого вам необходимо либо выполнить определенные действия для плагина, которые боты не могут выполнять при текущем состоянии технологий, либо ваше взаимодействие с нашим веб-сайтом будет проанализировано с помощью алгоритма. Ваш вклад и взаимодействие отправляются в Google и анализируются Google. Затем плагин предоставляет обратную связь о том, будете ли вы человеком или ботом, чтобы наш сайт мог соответствующим образом отреагировать. Данные в соответствии с Разделом 3 настоящей Политики конфиденциальности также отправляются в Google, даже если вы не используете плагин reCAPTCHA.Это происходит независимо от того, предоставил ли Google вам учетную запись пользователя, в которую вы вошли, или у вас вообще есть учетная запись пользователя. Если вы вошли в систему Google, ваши данные будут напрямую связаны с вашей учетной записью. Если вы не хотите, чтобы данные были связаны с вашим профилем Google, вы должны выйти из системы, прежде чем получить доступ к подстранице. Google хранит ваши данные в виде профилей использования и использует их в целях рекламы, исследования рынка и / или для разработки веб-сайта в соответствии с потребностями пользователей.Такой анализ проводится, в частности (даже для пользователей, которые не вошли в систему), для предоставления соответствующей рекламы и для информирования других пользователей социальной сети о ваших действиях на нашем веб-сайте. У вас есть право возражать против создания этих профилей пользователей, и в этом случае вы должны связаться с Google, чтобы воспользоваться этим правом. Мы не знаем, действительно ли Google использует ваш ввод и действия для подключаемого модуля reCAPTCHA в своих целях или связывает их с вашим профилем пользователя Google.

(3) Более подробная информация о целях и объеме сбора и обработки данных Google доступна в его политике конфиденциальности. Политика также предоставляет дополнительную информацию о ваших правах в этом отношении и настройках, которые вы можете использовать для защиты своей конфиденциальности: Google Ireland Ltd., Gordon House, Barrow Street, Dublin 4, Ирландия; https://www.google.de/intl/de/policies/privacy и https://www.google.com/policies/privacy/partners/?hl=en. Google LLC, материнская компания Google Ireland Ltd, соблюдает правила обмена конфиденциальной информацией между ЕС и США: https: // www.privacyshield.gov/EU-US-Framework

3. Интеграция прочих сервисов третьих лиц

(1) Этот веб-сайт также использует услуги, предоставляемые Google (Google Fonts для шрифтов и Google Tag Manager для управления тегами / надстройками) и Typotheque (для шрифтов). Используя эти услуги, мы можем предложить вам лучший пользовательский опыт на нашем веб-сайте. Это служит нашим интересам по повышению привлекательности нашего веб-сайта. Правовая основа для использования этих услуг обеспечивается статьей 6 (1) (f) GDPR.

(2) Когда вы посещаете веб-сайт, соответствующий сторонний провайдер будет проинформирован о том, что вы получили доступ к соответствующей подстранице нашего веб-сайта. Также отправляются данные в соответствии с Разделом 3 настоящей Политики конфиденциальности. Это происходит независимо от того, предоставил ли вам сторонний провайдер учетную запись пользователя, в которую вы вошли, или ее нет. Если вы вошли в систему стороннего провайдера, эти данные будут напрямую связаны с вашей учетной записью.Если вы не хотите, чтобы ваш профиль был связан со сторонним провайдером, вы должны выйти из системы перед посещением нашего веб-сайта. Сторонний провайдер может хранить эти данные в качестве профиля использования и использовать их в целях рекламы, исследования рынка и / или для разработки веб-сайта в соответствии с потребностями пользователей. Такой анализ проводится, в частности (даже для пользователей, которые не вошли в систему), для предоставления соответствующей рекламы и для информирования других пользователей социальной сети о ваших действиях на нашем веб-сайте.Вы имеете право возражать против создания этих профилей пользователей, при этом вы должны связаться с соответствующим сторонним поставщиком, чтобы воспользоваться этим правом.

(3) Дополнительная информация о целях и объеме сбора и обработки данных сторонним поставщиком предоставлена ​​в политиках конфиденциальности этих поставщиков, которые перечислены ниже. Политика также предоставляет дополнительную информацию о ваших правах в этом отношении и настройках, которые вы можете использовать для защиты своей конфиденциальности:

(4) Адреса соответствующих поставщиков и URL-адреса с их политиками конфиденциальности данных:

а) Google Ireland Ltd., Gordon House, Barrow Street, Dublin 4, Ирландия; https://www.google.de/intl/de/policies/privacy и https://www.google.com/policies/privacy/partners/?hl=en. Google LLC, материнская компания Google Ireland Ltd, соблюдает правила обмена конфиденциальной информацией между ЕС и США: https://www.privacyshield.gov/EU-US-Framework

.

b) Typotheque, Zwaardstraat 16, 2584 TX Гаага, Нидерланды; https://www.typotheque.com/tag/privacy

Дата: 23.02.2020

игорь-александров / яндекс-вебмастер: Ruby wrapper для Яндекс.API для веб-мастеров

Обертка для API Яндекс.Вебмастера.

О Яндекс.Вебмастере

Документация API

Установка

  [sudo] gem установить яндекс-вебмастер
  

Использование

Аутентификация

API Яндекса использует OAuth для аутентификации. К счастью, жемчужина Яндекс :: Вебмастера скрывает от вас большую часть деталей.

Если вы никогда не использовали Webmaster API или хотите изменить свои учетные данные для аутентификации или срок действия вашего токена авторизации истек, то вам следует создать новый:

 требуют 'rubygems'
требуется 'яндекс-вебмастер'

# Получите свои учетные данные API на https: // oauth.yandex.ru/
webmaster = Яндекс :: Webmaster.new (: app_id => 'your_app_id',: app_password => 'your_app_password')
  => # <Яндекс :: Вебмастер :: Клиент>

# Следуйте URL-адресу авторизации, вы будете перенаправлены на URL-адрес обратного вызова, указанный в настройках вашего приложения.
webmaster.authorize_url
  => "https://oauth.yandex.ru/authorize?response_type=code&client_id=your_app_id"

# Используйте код авторизации из params, чтобы получить токен авторизации
webmaster.authenticate (параметры [: код])
  => # <Яндекс :: Вебмастер :: Клиент>

# Если ошибки не возникает, вы можете использовать любой метод API
# Чтобы посмотреть, какой токен сейчас используется, вызовите конфигурацию клиента
токен = веб-мастер.configuration.oauth_token
  => "82af4af2a42e4019bd59a325da0f31d8" 

Если вы хотите восстановить ранее использованный токен, это тоже легко сделать:

 требуют 'rubygems'
требуется 'яндекс-вебмастер'

# получите учетные данные API на https://oauth.yandex.ru/
webmaster = Яндекс :: Webmaster.new (: oauth_token => 'token')
  => # <Яндекс :: Вебмастер :: Клиент> 

Чтобы проверить, аутентифицирован ли ваш клиент или нет, используйте Authenticated? метод.

 # Мы уже инициализировали клиент раньше.webmaster.authenticated?
  => правда 

Операции со списком сайтов

Получить список сайтов

Большинство методов загрузки Яндекс :: Вебмастера ленивы, данные будут загружены только тогда, когда они вам действительно понадобятся.

 webmaster.hosts
  => # <Яндекс :: Вебмастер :: ApiFactory>
webmaster.hosts.all
  => # <Массив [Яндекс :: Вебмастер :: Хост]>
# на самом деле это не делает запрос к API, перечисляет, кэшируются ли хосты.
webmaster.hosts.first
  => # <Яндекс :: Вебмастер :: Хост> 

Чтобы перезагрузить список хостов, вызовите метод #host с явно переданным параметром reload .

 # вызывает API и кеширует список хостов
webmaster.hosts (правда) .all
  => # <Массив [Яндекс :: Вебмастер :: Хост]>
# очищает кеш и снова вызывает API.
webmaster.hosts (правда) .first
  => # <Яндекс :: Вебмастер :: Хост> 

Создать сайт

 webmaster.hosts.create ('имя хоста')
  => # <Яндекс :: Вебмастер :: Хост> 

Операции с сайтом

Получение ресурсов сайта

Вы можете легко узнать, какие методы API доступны для выбранного хоста.

 h = webmaster.hosts.last
  => # <Яндекс :: Вебмастер :: Хост>
  
h.resources
  => {: host_information => "https://webmaster.yandex.ru/api/v2/hosts/  / stats",: verify_host => "https://webmaster.yandex.ru/api/v2/ hosts /  / verify "...: excluded_urls_history =>" https://webmaster.yandex.ru/api/v2/hosts/  / history / excluded-urls "} 

Удаление сайта

 h = webmaster.hosts.last
  => # <Яндекс :: Вебмастер :: Хост>
  
часУдалить
  => # <Яндекс :: Вебмастер :: Хост>

ч.удалено?
  => правда 

Операции со статистикой сайта

Запрос обновляет следующие поля в узле:

  • # имя
  • #verification
  • #crawling
  • #virused
  • #last_access
  • #tic
  • #url_count
  • #index_count

Также запрос заполняет следующие поля:

  • #url_errors
  • #internal_links_count
  • #links_count
 h = веб-мастер.хосты.последний
  => # <Яндекс :: Вебмастер :: Хост>

# Заполняет экземпляр хоста статистической информацией
h.load_stats
  => # <Яндекс :: Вебмастер :: Хост>

h.url_errors
  => 379843
h.internal_links_count
  => 52367
h.links_count
  => 943 

Операции с файлами Sitemap

Получение списка файлов Sitemap

 # вызывает API и кэширует список карт сайта для хоста
webmaster.hosts.first.sitemaps
  => # <Массив [Яндекс :: Вебмастер :: Хосты :: Карта сайта]> 

Чтобы перезагрузить список карт сайта для хоста, вызовите метод #host с явно переданным параметром reload .

 webmaster.hosts.first.sitemaps (true)
  => # <Массив [Яндекс :: Вебмастер :: Хосты :: Карта сайта]> 

Получение информации о файле Sitemap сайта

Для загрузки подробной информации о файле Sitemap используйте метод #load_details .

 sitemap = webmaster.hosts.first.sitemaps.first
  => # <Яндекс :: Вебмастер :: Хосты :: Карта сайта>
sitemap.load_details
  => # <Яндекс :: Вебмастер :: Хосты :: Карта сайта> 

Когда детали загружены, вы можете увидеть информацию Sitemap.

 sitemap.latest_info
  => # <Яндекс :: Вебмастер :: Хосты :: SitemapInfo>
sitemap.in_search_info
  => # <Яндекс :: Вебмастер :: Хосты :: SitemapInfo> 

Удаление файла Sitemap

 sitemap = webmaster.hosts.first.sitemaps.first
  => # <Яндекс :: Вебмастер :: Хосты :: Карта сайта>
sitemap.delete
  => # <Яндекс :: Вебмастер :: Хост>
sitemap.deleted?
  => правда 

Операции с верификацией сайта

Базовая проверочная информация загружается вместе с загрузкой хоста.

Для проверенных сайтов:

 h = webmaster.hosts.last
  => # <Яндекс :: Вебмастер :: Хост>
ч. проверка
  # <Яндекс :: Вебмастер :: Хосты :: Состояние проверки: "проверено"> 

А для непроверенных сайтов:

 h = webmaster.hosts.create ('http://www.tver.ru')
ч. проверка
 => # <Яндекс :: Вебмастер :: Хосты :: Состояние проверки: "never_verified"> 

Примечание о исправлениях / запросах на извлечение

  • Вилка проект.
  • Добавьте функцию или исправьте ошибку.
  • Добавьте тесты для этого. Это важно, поэтому я не разбиваю его будущая версия непреднамеренно.
  • Зафиксируйте, не связывайтесь с rakefile, версией или историей. (если вы хотите иметь свою версию, это нормально, но bump версию в коммите, я могу игнорировать, когда вытаскиваю)
  • Отправьте мне запрос на перенос. Бонусные баллы за тематические ветки.

Кредиты

Webmaster поддерживается JetRockets.

Авторы:

Лицензия

Это бесплатное программное обеспечение, которое может распространяться в соответствии с условиями, указанными в файле ЛИЦЕНЗИИ.

Факты и цифры о пользователях: Аудитория Яндекса

Русский поисковый маркетинг недавно опубликовал серию блогов, в которой оценивались российские пользователи Интернета по возрастным группам, анализируя общую онлайн-активность, использование социальных сетей, онлайн-продажи и предпочтения в электронных платежах. Сериал дает прекрасную общую картину различных типов поведения в Интернете среди российских пользователей. В дополнение к серии, этот блог ориентирован на интернет-аудиторию Яндекса, чтобы дать рекламодателям больше информации об их российских предпочтениях в области цифровой рекламы и таргетинге на пользователей.

Россия расположена в 11 часовых поясах, в ней проживает 143 миллиона человек. Среди этих людей 83 миллиона человек или 60% населения являются пользователями Интернета; что делает Россию крупнейшей интернет-аудиторией во всей Европе. Низкое проникновение Интернета в России предлагает предприятиям невероятные возможности для роста, а пользователям — значительные возможности для развития их использования. Общая аудитория поддерживает определенное поведение пользователя в зависимости от возраста, пола и местоположения. Яндекс, являясь доминирующей поисковой системой в России, охватывает большинство российских пользователей Интернета.В этом блоге рассматривается аудитория Яндекса в целом и, в частности, различные сервисы, на которых рекламодатели могут размещать медийную рекламу.

Яндекс Аудитория

Яндекс — одна из крупнейших интернет-компаний Европы и ведущая поисковая система в России. Помимо поиска, Яндекс предлагает множество сервисов 53 миллионам пользователей в месяц и 20 миллионам уникальных ежедневных зрителей.

На главной странице Яндекса 20 миллионов пользователей ежедневно и 42 миллиона пользователей ежемесячно ищут ваши товары и услуги.Яндекс занимает 58% российского поискового рынка с большим ежедневным охватом, чем местные российские телеканалы.

Яндекс обрабатывает более 5 миллиардов поисковых запросов в месяц, показывая рекламу 70 миллионам человек каждый день через платную поисковую рекламу Яндекс.Директа. Яндекс обслуживает 56% всего населения России. В целом аудитория Яндекса довольно равномерно разделена между мужчинами и женщинами, но женщины немного перевешивают пользователей-мужчин. Самая большая демографическая группа — это женщины в возрасте от 45 до 64 лет.Однако приведенная ниже статистика исследования TNS об использовании настольных компьютеров не включает мобильных пользователей, которые, как правило, относятся к более молодому поколению.

Подобно общим тенденциям для пользователей Интернета, значительная часть трафика Яндекса поступает из двух крупнейших и известных городов страны, Москвы и Санкт-Петербурга, но пользователи Яндекса расположены по всей России. Рекламодатели Яндекс.Директа могут лучше спланировать свой геотаргетинг, выполнив поиск по вашим ключевым словам в Яндекс.Wordstat и просмотрев опцию карты, чтобы увидеть, как объем запросов делится по местоположению.

Advertiers также могут получить еще более четкое представление о демографических данных, установив и просматривая аналитику в Яндекс.Метрике, бесплатном инструменте веб-аналитики Яндекса, который предлагает важную информацию о демографии и поведении пользователей.

Аудитория медийной рекламы Яндекса

Яндекс предлагает размещение медийной рекламы как на главной странице, так и в самых популярных сервисах, которые содержат только один медийный баннер на каждой странице, чтобы обеспечить высокую видимость и заинтересованность. Рекламодатели выбирают один из нескольких вариантов таргетинга, включая возраст и пол, но также могут размещать рекламу на страницах с аудиторией, более подходящей для их продуктов и услуг.В этом разделе дается краткий обзор некоторых наиболее популярных сервисов и профилей аудитории Яндекса.

Яндекс управляет КиноПоиском, одним из крупнейших российских киносайтов. Этот веб-сайт, входящий в топ-20 России, обслуживает около 15 миллионов пользователей в месяц, в основном из крупных городов, от 25 до 34 лет.

Яндекс.Музыка предлагает персонализированный музыкальный сервис более чем 8 миллионам пользователей в месяц. Средний возраст пользователей составляет 18-34 года, и 70% пользователей имеют доход и выше.

Яндекс.Погода предоставляет подробный прогноз погоды для 2600 городов по всему миру. Ежемесячная аудитория Яндекс.Погода составляет более 14 миллионов пользователей, большинству из которых от 18 до 34 лет. Ежемесячная аудитория включает большую долю пользователей женского пола.

Яндекс.Карты предоставляют качественные, подробные карты, включая информацию о пробках. Яндекс.Карты помогают более 20 миллионам пользователей в месяц, в основном автовладельцам от 25 до 44 лет.

Яндекс.Таблицы — информационный сервис, отображающий расписание рейсов, поездов и автобусов.Яндекс.Таблицы ежемесячно предоставляют информацию более чем 4 миллионам пользователей. В аудитории преобладают пользователи-мужчины и частые путешественники в возрасте от 25 до 34 лет.

Яндекс.ТВ — сервис онлайн-просмотра телепрограмм и телегидов. Ежемесячная аудитория Яндекс.TV составляет 9 миллионов пользователей, половина из которых в возрасте от 25 до 44 лет.

Яндекс.Новости — сервис-агрегатор новостей. В аудитории Яндекс.Новостей, которая составляет 24 миллиона пользователей в месяц, преобладают профессионалы с высоким уровнем дохода в возрасте от 34 до 44 лет.

Яндекс.Перевод — это сервис машинного перевода на 53 языка. Яндекс.Переводчик помогает более 5 миллионам пользователей ежемесячно переводить голосовые, текстовые и графические переводы. Аудитория варьируется, но привлекает значительную часть пользователей как внутри страны, так и за рубежом.

Полный список сервисов Яндекса для отображения баннерной, видео- и аудиорекламы читайте здесь. Социально-демографический таргетинг Яндекс предоставляет рекламодателям не только рекламу, основанную на соответствующих аудиториях каждой услуги, но и возможность настраивать таргетинг на аудитории по полу, возрасту и уровню дохода.Рекламодатели также могут ориентироваться на свою аудиторию по географии и интересам.

Как всегда, имейте в виду, что чем лучше вы знаете свою аудиторию, тем лучше вы можете оптимизировать свои целевые страницы и рекламу. Русский язык и варианты оплаты на ваших целевых страницах не менее важны, чем ориентация на правильную демографию.

Яндекс. Персонализированный поиск в Интернете.

Мы рады объявить о запуске Yandex Personalized Web Search Challenge , который является частью семинара WSDM 2014 Web Search Click Data (WSCD).Конкурс проводится на Kaggle и предоставляет уникальную возможность консолидировать и тщательно изучить работу промышленных лабораторий по персонализации веб-поиска с использованием контекста поведения пользователей при поиске. Он также предоставляет полностью анонимный набор данных, используемый Яндексом, в котором есть анонимные идентификаторы пользователей, запросы, условия запроса, URL-адреса, домены URL-адресов и клики. Этот вызов и общий набор данных позволят совершенно новому набору исследователей изучить проблему персонализации поиска в Интернете.

Задача задумана как логическое продолжение двух предыдущих задач.Мы просим участников повторно ранжировать URL-адреса каждой выдачи, возвращаемой поисковой системой, в соответствии с личными предпочтениями пользователей. Другими словами, участникам необходимо персонализировать поиск, используя долгосрочный (на основе истории пользователя) и краткосрочный (на основе сеанса) контекст пользователя.

Оценка основана на варианте модели персональной релевантности, основанной на времени ожидания, и основана на данных, как это принято в настоящее время в современных исследованиях персонализированного поиска.

The Challenge является частью семинара Web Search Click Data (WSCD 2014), и отчеты лучших команд могут быть представлены на этом семинаре, который состоится на конференции WSDM 2014 28 февраля 2013 года, Нью-Йорк, СОЕДИНЕННЫЕ ШТАТЫ АМЕРИКИ.Организаторы семинара — Павел Сердюков (Яндекс), Жорж Дюпре (Yahoo!) и Ник Красвелл (Microsoft Research / Bing).

Участники могут участвовать как индивидуально, так и в составе команд. Подробное описание задачи, наборов данных и методологии оценки результатов вы найдете по адресу:

https://www.kaggle.com/c/yandex-personalized-web-search-challenge

Важные даты:

  • 11 октября 2013 г. — конкурс открыт
  • 20 декабря 2013 г. — Регистрация новых участников прекращается
  • 10 января 2014 г. — Конец испытания (23:59 UTC)
  • 14 января 2014 г. — объявлены предварительные победители
  • 30 января 2014 г. — крайний срок подачи отчетов
  • 28 февраля 2014 г. — семинар WSCD на WSDM 2014 и объявление победителей

Три лучших участника получат следующие денежные призы:

  • 1 место: 5000 долларов
  • 2 место: 3000 долларов
  • 3 место: 1000 долларов

Challenge Организаторы:
Павел Сердюков, Евгений Харитонов (Яндекс)

Что такое Яндекс? Подробное руководство

Повысьте свой уровень SEO

Начинающий
6 мин.

Технологические гиганты, такие как Amazon и Facebook, регулярно публикуют новости в заголовках.Слово Google стало полностью синонимом слова «поиск в Интернете». Можно подумать, что эти компании — наряду с некоторыми другими, такими как Yahoo или Bing — обладают полной монополией в индустрии высоких технологий.

Тем не менее, миллиарды людей используют Интернет каждый день, и эти в основном американские англоязычные компании не могут полностью удовлетворить потребности всех этих разнообразных пользователей.

Тот факт, что бренд не является общеизвестным в Америке, не означает, что он не играет большой роли в онлайн-пространстве.

Одной из таких компаний, которая продолжает оставаться важной частью технологической индустрии, является основанная в России компания Яндекс. Яндекс, в первую очередь известный как поисковая система, продолжает вводить новшества не только в области поисковых алгоритмов, но и в области искусственного интеллекта, аналитики, веб-разработки и многого другого.

Как и многие другие поставщики поисковых систем, большую часть доходов Яндекс получает от контекстной поисковой рекламы. По сути, компании платят Яндексу за помощь в продвижении своего бизнеса через поисковую платформу.Как и в Google, при поиске на Яндексе вы найдете сотни результатов по вашему конкретному поисковому запросу.

Домашняя страница Яндекс, самой популярной поисковой системы в России

Хотя большинство результатов основаны на релевантности, некоторые из них являются результатом платной рекламы.

Конечно, поисковые системы всегда работают, чтобы предоставить релевантный контент на основе определенных формулировок, но важно отметить, что некоторые результаты имеют самый высокий рейтинг из-за платной рекламы. Сложность заключается в том, чтобы сбалансировать потребности спонсоров с алгоритмом поиска, чтобы конечный пользователь получил наилучший возможный результат.

Яндекс работает над тем, чтобы предоставлять релевантные результаты поиска в надежде предоставить полезный и эффективный продукт для тех, кто пользуется их поисковой системой. Возвращая релевантные результаты своим пользователям, они работают над укреплением доверия в своем сообществе и повышают вероятность того, что пользователи разовьют лояльность по отношению к их платформе.

В этом кратком руководстве мы исследуем историю Яндекса и выделим некоторые способы, которыми эта компания в настоящее время продвигает инновации за пределы поисковых систем.

Как Яндекс строит технологическую империю в поиске и искусственном интеллекте

Яндекс — технологическая компания, известная своим набором сервисов, охватывающих поисковые системы, искусственный интеллект и даже аналитику. Все они созданы с целью помочь пользователям ориентироваться как в онлайн, так и в офлайновом мире. Компания «Яндекс», основанная в 1997 году, работала над тем, чтобы предоставлять пользователям релевантные и полезные результаты поиска, используя при этом различные высокотехнологичные алгоритмы, чтобы гарантировать ценность результатов.

Для успеха любой поисковой системы она должна предоставлять пользователям последовательные и релевантные результаты.Например, если вы пишете статью по истории и набираете в поисковой системе «деревня Ярлсбург в Норвегии», но получаете только результаты, связанные с сыром, вы, вероятно, не будете очень довольны. Ежедневно в Интернете выполняются миллиарды поисковых запросов, и все они требуют значительных ресурсов, чтобы обеспечить возврат релевантных результатов. Среднестатистический интернет-пользователь часто воспринимает невероятную сложность интернет-поиска как должное, ожидая, что любой поиск каждый раз будет давать ценные результаты.

Хотя Яндекс продолжает оставаться лидером поисковых систем, как и другие подобные организации, они также предлагают широкий спектр других продуктов и услуг. С 1997 года они продолжали работать над созданием своего набора технических предложений и услуг, чтобы помочь своим пользователям развивать бизнес, находить релевантные результаты поиска и разбираться в бизнес-аналитике.

Яндекс котируется на бирже NASDAQ с 2011 года и продолжает оставаться популярным вариантом для тех, кто хочет инвестировать в растущие и прибыльные технологические компании.

История поисковых систем

На заре Интернета пользователям нужно было переходить к определенным общим файлам, чтобы воспользоваться преимуществами подключения к Интернету. Даже самым ранним поисковым системам не хватало возможностей естественного языка, необходимых для оценки релевантности результатов. Однако по мере развития Интернета поисковые системы стали более эффективными, просматривая миллиарды фрагментов данных и возвращая точную и ценную информацию, часто за считанные секунды.

Поисковые системы играют решающую роль в развитии и создании Интернета, поскольку они позволяют среднему пользователю быстро найти то, что он ищет. В конечном итоге такие поисковые системы, как Яндекс, работают над тем, чтобы сделать всю информацию в Интернете доступной одним нажатием нескольких клавиш.
«Русский Google и Amazon»

Компания Яндекс, основанная в 1997 году, занимается созданием интернет-сервисов более двадцати лет и продолжает использовать новейшие технологии для улучшения своих продуктов для пользователей.В настоящее время это крупнейшая технологическая компания в России, занимающая более 50% рынка поисковых систем в этой стране.

Согласно последним статистическим данным, Яндекс — четвертый по популярности сайт в России, и он играет ключевую роль в повседневном использовании Интернета россиянами и другими людьми. Благодаря инновациям в области искусственного интеллекта и технологий чтения данных Яндекс может легко переводить общеупотребительные русские термины, мгновенно позволяя россиянам быстро находить релевантные результаты, в то время как некоторые другие варианты поисковых систем не работают.

Основанный Аркадием Воложом и Ильей Сегаловичем в 1997 году, название «Яндекс» происходит от термина «Еще один ИНДЕКСЕР». Помимо доминирования на поисковом рынке в России, Яндекс также имеет значительные инвестиции в компанию по аренде пассажиров Uber для российского рынка. Будучи в первую очередь поисковой компанией, как и другие технологические гиганты, Яндекс также предоставляет широкий спектр других важных интернет-услуг для предприятий и частных лиц по всему миру.

Яндекс выходит за рамки поиска

Хотя невероятный успех Яндекса является результатом его сильной поисковой системы, его цель как организации — помочь пользователям эффективно пользоваться Интернетом.Вот несколько ключевых предложений для бизнеса, которые в настоящее время предоставляет Яндекс.

API карт

Яндекс предлагает обширный набор картографических данных. API карт позволяют программам, приложениям и другим приложениям предоставлять точные данные о местоположении для самых разных целей. Для многих разработчиков доступ к этим картографическим данным имеет решающее значение для создания полнофункционального приложения или сервиса. Сотни компаний по всему миру полагаются на него. Их картографические данные являются лидерами в отрасли по точности.

Управление базой данных — Click House

Помимо API карт, Яндекс также предлагает системы управления данными для предприятий, которые собирают большой объем информации.Click House позволяет клиентам быстро отслеживать, анализировать и систематизировать большие объемы данных, чтобы принимать более обоснованные бизнес-решения и отслеживать важные показатели.

Речевой комплект

Яндекс также является лидером отрасли в разработке речевых технологий, чтобы сделать работу в Интернете удобнее для людей с самыми разными потребностями. Используя облачные сервисы, Яндекс предоставляет различные технологии распознавания речи организациям, которым требуются интегрированные решения для своих мобильных приложений.

Cat Boost

Cat Boost, одна из самых популярных корпоративных услуг, представляет собой высокотехнологичный алгоритм, используемый для прогнозирования больших объемов данных, чтобы предприятия могли принимать более эффективные решения в своей организации. Cat Boost может ранжировать задачи, а также давать рекомендации на основе предоставленных данных.

App Metrica

Наконец, Яндекс предлагает набор аналитического программного обеспечения для отслеживания показателей и производительности приложений от отдельных разработчиков до крупных корпораций.Этот бесплатный инструмент аналитики дает конечному пользователю возможность точно отслеживать и понимать свои показатели данных, которые можно использовать для дальнейшего улучшения конкретного приложения, продукта или услуги.

Яндекс и Конфиденциальность

Яндекс — лидер отрасли в вопросах конфиденциальности и прибыльного бизнеса в области контекстной рекламы. Компания использует различные меры конфиденциальности, чтобы гарантировать, что данные пользователей защищены и используются только для улучшения работы конечных пользователей. Как и многие поисковые системы по всему миру, они продолжают повышать свою приверженность конфиденциальности, поскольку пользователи ожидают, что их данные останутся в безопасности.

Будущее AI

Одна из областей, в которой Яндекс выделяется среди своих конкурентов, заключается в том, что он активно инвестирует в ИИ, чтобы помочь улучшить все варианты своих услуг. Недавно сотрудники отметили годовщину выпуска своего интеллектуального помощника с искусственным интеллектом по имени «Алиса». Алиса была разработана для точного и естественного общения с пользователями. За последний год она стала неотъемлемой частью повседневной жизни многих пользователей.

Они могут полагаться на Алису при планировании встреч, сообщать ежедневные новости, ставить задачи в календарях и многое другое.Ассистенты на базе искусственного интеллекта, включая Siri, Alexa и Google Home, становятся все более популярными для повседневного использования. Алиса даже позволяет пользователю загрузить фотографию объекта, а затем отправляет ее в Alexa для результатов поиска изображений, чтобы определить, что это за объект.